3300013466: Human skin bacterial and viral communities - University of Pennsylvania - MG100688

Overview

Basic Information

• IMG/M Taxon OID: 3300013466
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118646 | Gp0138338 | Ga0118449
• Sample Name: Human skin bacterial and viral communities - University of Pennsylvania - MG100688
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Pennsylvania
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 14891134
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Skin Bacterial And Viral Communities - University Of Pennsylvania
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060965	Metagenome / Metatranscriptome	132	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0118449_102869	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	764

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0118449_102869	Ga0118449_1028693	F060965	VRPITVCWWLGTFTPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN*