3300002737: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA

Overview

Basic Information

• IMG/M Taxon OID: 3300002737
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053073 | Gp0061149 | Ga0007029
• Sample Name: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 118438046
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. CF444	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
• Type: Host-Associated
• Taxonomy: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: University of North Carolina, USA
• Coordinates
  • Lat. (^o): 35.9082
  • Long. (^o): -79.0499
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060965	Metagenome / Metatranscriptome	132	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI25162J39368_1002211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. CF444	8009

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI25162J39368_1002211	JGI25162J39368_100221117	F060965	MRYSSINNVKLTLALFMTRFCADNTNNAFALDDFAVAADPLD*