| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013652 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118646 | Gp0138086 | Ga0118149 |
| Sample Name | Human skin bacterial and viral communities - University of Pennsylvania - MG100426 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Pennsylvania |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 6149549 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Skin Bacterial And Viral Communities - University Of Pennsylvania |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060965 | Metagenome / Metatranscriptome | 132 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0118149_101617 | Not Available | 533 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0118149_101617 | Ga0118149_1016172 | F060965 | ITVCWWLGTFTPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| ⦗Top⦘ |