3300031112: Phyllosphere microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSL A.R2

Overview

Basic Information

• IMG/M Taxon OID: 3300031112
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133512 | Gp0324012 | Ga0308156
• Sample Name: Phyllosphere microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSL A.R2
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 536023527
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States
• Type: Host-Associated
• Taxonomy: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Unclassified

Location Information

• Location: USA: California
• Coordinates
  • Lat. (^o): 37.8864
  • Long. (^o): -122.2981
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060965	Metagenome / Metatranscriptome	132	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0308156_1117197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	768

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0308156_1117197	Ga0308156_11171973	F060965	CWWLGTLTPAIRAIRYSSKLTLTLLVTRLDADHTDHALALDDLAVAADPLD