3300007058: Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut

Overview

Basic Information

• IMG/M Taxon OID: 3300007058
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114771 | Gp0126732 | Ga0104043
• Sample Name: Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut
• Sequencing Status: Permanent Draft
• Sequencing Center: Cornell University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 55383107
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Drosophila Gut Microbial Communities From New York, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Drosophila Neotestacea Female Adult Gut → Drosophila Gut Microbial Communities From New York, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: Mendon Ponds Park, Monroe County, NY, USA
• Coordinates
  • Lat. (^o): 43.025606
  • Long. (^o): -77.572811
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060965	Metagenome / Metatranscriptome	132	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0104043_1098429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	723

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0104043_1098429	Ga0104043_10984292	F060965	MRYSLINNVKLTLALFMTRFGANYTNYAMALDDLTVAADPLY*