| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007192 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117930 | Gp0126580 | Ga0103268 |
| Sample Name | Ant gut microbial communities from Cephalotes persimplex, Brazil |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Harvard University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 230860795 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Cephalotes Ants Gut Microbiomes |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Ant Gut → Cephalotes Ants Gut Microbiomes |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | CICRA, Madre de Dios, Peru | |||||||
| Coordinates | Lat. (o) | -12.5 | Long. (o) | -70.1 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054614 | Metagenome / Metatranscriptome | 139 | Y |
| F055821 | Metagenome | 138 | Y |
| F060965 | Metagenome / Metatranscriptome | 132 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103268_1073729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 853 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103268_1048886 | Ga0103268_10488864 | F055821 | VVKIVAKLINCIKEEQRSVMRFLCTEDVPDAQIHFRMCAQYR* |
| Ga0103268_1072637 | Ga0103268_10726372 | F054614 | MSLTFTLTGKSSILAVSYFPTVDLNDGDYELSLTDFETNYTIPNVNLSNNKFYFDKDDKEIVIPEGSYELHDIDK |
| Ga0103268_1073729 | Ga0103268_10737293 | F060965 | MRYSLIDNVTLTLALLVTWLATNDTNNTLALDDFAVAANPLD* |
| ⦗Top⦘ |