3300005630: Enriched soil aggregate microbial communities from Iowa State university to study microbial drivers of carbon cycling - Hofmockel_1000072-3 ISU MetaT (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300005630
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114432 | Gp0111842 | Ga0068834
• Sample Name: Enriched soil aggregate microbial communities from Iowa State university to study microbial drivers of carbon cycling - Hofmockel_1000072-3 ISU MetaT (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 29144674
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → research facility → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Iowa
• Coordinates
  • Lat. (^o): 42.0266187
  • Long. (^o): -93.6486594
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060965	Metagenome / Metatranscriptome	132	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0068834_100137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	747

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0068834_100137	Ga0068834_1001371	F060965	GVLMVGDFTPAIRAIRYSSINNVLTLTLLMARLGADDTNHALALDDLAVAANPLD*