| Basic Information | |
|---|---|
| Family ID | F025141 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 203 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MIQCEYCPRGFIETANGLAEKTFHELLHEPEVVNK |
| Number of Associated Samples | 170 |
| Number of Associated Scaffolds | 203 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 40.89 % |
| % of genes from short scaffolds (< 2000 bps) | 74.88 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (89.655 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine (12.808 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.739 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (59.113 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.40% β-sheet: 6.35% Coil/Unstructured: 68.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 203 Family Scaffolds |
|---|---|---|
| PF00999 | Na_H_Exchanger | 13.30 |
| PF13641 | Glyco_tranf_2_3 | 3.94 |
| PF00252 | Ribosomal_L16 | 1.97 |
| PF02778 | tRNA_int_endo_N | 1.48 |
| PF00581 | Rhodanese | 0.99 |
| PF13187 | Fer4_9 | 0.99 |
| PF12838 | Fer4_7 | 0.99 |
| PF01513 | NAD_kinase | 0.49 |
| PF04402 | SIMPL | 0.49 |
| PF13685 | Fe-ADH_2 | 0.49 |
| PF08734 | GYD | 0.49 |
| PF00572 | Ribosomal_L13 | 0.49 |
| PF12840 | HTH_20 | 0.49 |
| PF13632 | Glyco_trans_2_3 | 0.49 |
| PF01061 | ABC2_membrane | 0.49 |
| PF13307 | Helicase_C_2 | 0.49 |
| PF14947 | HTH_45 | 0.49 |
| PF10559 | Plug_translocon | 0.49 |
| PF03167 | UDG | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 203 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 13.30 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 13.30 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 13.30 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 13.30 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 13.30 |
| COG0197 | Ribosomal protein L16/L10AE | Translation, ribosomal structure and biogenesis [J] | 1.97 |
| COG1676 | tRNA splicing endonuclease subunit SEN34 | Translation, ribosomal structure and biogenesis [J] | 1.48 |
| COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.49 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.49 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.49 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.49 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.49 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.66 % |
| Unclassified | root | N/A | 10.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2061766003|GB_4MN_MetaGALL_nosff_rep_c91493 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1550 | Open in IMG/M |
| 2088090013|LWAnNN_GHFF8UE02JMLSA | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 506 | Open in IMG/M |
| 2236876008|none_p543167 | Not Available | 503 | Open in IMG/M |
| 2236876009|none_p085654 | All Organisms → cellular organisms → Archaea | 516 | Open in IMG/M |
| 2263196002|LD2009400mD_c02782 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1291 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10065278 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1499 | Open in IMG/M |
| 3300000136|KGI_S1_ANT02_95mDRAFT_c10038404 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1556 | Open in IMG/M |
| 3300000141|LPjun08P41300mDRAFT_c1007480 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2056 | Open in IMG/M |
| 3300000141|LPjun08P41300mDRAFT_c1045753 | All Organisms → cellular organisms → Archaea | 557 | Open in IMG/M |
| 3300000142|LPaug09P16500mDRAFT_c1040896 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 690 | Open in IMG/M |
| 3300000142|LPaug09P16500mDRAFT_c1066495 | All Organisms → cellular organisms → Archaea | 504 | Open in IMG/M |
| 3300000143|SI53jan11_10mDRAFT_c101263 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1349 | Open in IMG/M |
| 3300000152|LPjun08P12500mDRAFT_c1043448 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 632 | Open in IMG/M |
| 3300000155|SI36aug09_200mDRAFT_c1013720 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 744 | Open in IMG/M |
| 3300000157|LPaug08P261000mDRAFT_c1048246 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 537 | Open in IMG/M |
| 3300000164|SI39no09_200mDRAFT_c1051752 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 747 | Open in IMG/M |
| 3300000170|SI36aug09_135mDRAFT_c1029413 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 876 | Open in IMG/M |
| 3300000179|LPjun09P16500mDRAFT_c1048379 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 554 | Open in IMG/M |
| 3300000186|LPfeb10P162000mDRAFT_c1004360 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1079 | Open in IMG/M |
| 3300000222|LPjun09P12500mDRAFT_1024166 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1167 | Open in IMG/M |
| 3300000222|LPjun09P12500mDRAFT_1072456 | All Organisms → cellular organisms → Archaea | 532 | Open in IMG/M |
| 3300000238|SI36aug09_100mDRAFT_1044867 | All Organisms → cellular organisms → Archaea | 505 | Open in IMG/M |
| 3300000254|SI34jun09_100mDRAFT_1002383 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 6746 | Open in IMG/M |
| 3300000256|LP_F_10_SI03_120DRAFT_1017701 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 1738 | Open in IMG/M |
| 3300000259|LP_J_08_P26_500DRAFT_1006548 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1953 | Open in IMG/M |
| 3300000323|LPaug09P202000mDRAFT_1017239 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1196 | Open in IMG/M |
| 3300000574|JGI1357J11328_10000232 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosarchaeum | 49059 | Open in IMG/M |
| 3300000950|JGI11881J13070_1004065 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1396 | Open in IMG/M |
| 3300001073|C687J13245_100092 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 3732 | Open in IMG/M |
| 3300001133|C687J13250_100354 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1871 | Open in IMG/M |
| 3300001380|JGI1356J14229_10164012 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 678 | Open in IMG/M |
| 3300001683|GBIDBA_10060735 | All Organisms → cellular organisms → Archaea | 1893 | Open in IMG/M |
| 3300001771|Beebe_1051069 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 532 | Open in IMG/M |
| 3300001959|GOS2247_1066119 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1540 | Open in IMG/M |
| 3300001968|GOS2236_1003289 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 1806 | Open in IMG/M |
| 3300002036|BIB32012_10117513 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 886 | Open in IMG/M |
| 3300002036|BIB32012_10135970 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 801 | Open in IMG/M |
| 3300002231|KVRMV2_100121374 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus salaria | 3906 | Open in IMG/M |
| 3300002231|KVRMV2_101927479 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 534 | Open in IMG/M |
| 3300002965|JGI26063J44948_1052903 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 775 | Open in IMG/M |
| 3300003153|Ga0052192_1001033 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1550 | Open in IMG/M |
| 3300004150|Ga0055520_10166088 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 542 | Open in IMG/M |
| 3300004213|Ga0066648_10660688 | All Organisms → cellular organisms → Archaea | 586 | Open in IMG/M |
| 3300004278|Ga0066609_10057446 | All Organisms → cellular organisms → Archaea | 1323 | Open in IMG/M |
| 3300005427|Ga0066851_10066126 | All Organisms → cellular organisms → Archaea | 1205 | Open in IMG/M |
| 3300005589|Ga0070729_10414785 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 745 | Open in IMG/M |
| 3300005590|Ga0070727_10026683 | All Organisms → cellular organisms → Archaea | 3706 | Open in IMG/M |
| 3300005592|Ga0066838_10102033 | All Organisms → cellular organisms → Archaea | 811 | Open in IMG/M |
| 3300005593|Ga0066837_10000839 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 14320 | Open in IMG/M |
| 3300005593|Ga0066837_10103903 | All Organisms → cellular organisms → Archaea → TACK group | 1045 | Open in IMG/M |
| 3300005600|Ga0070726_10178744 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1087 | Open in IMG/M |
| 3300005601|Ga0070722_10005885 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 3454 | Open in IMG/M |
| 3300005601|Ga0070722_10020719 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2110 | Open in IMG/M |
| 3300005825|Ga0074476_1395590 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 887 | Open in IMG/M |
| 3300005828|Ga0074475_10975199 | All Organisms → cellular organisms → Archaea | 1630 | Open in IMG/M |
| 3300005829|Ga0074479_10090402 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | 9382 | Open in IMG/M |
| 3300005829|Ga0074479_10767911 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis chungbukensis | 37839 | Open in IMG/M |
| 3300005945|Ga0066381_10156508 | Not Available | 652 | Open in IMG/M |
| 3300005945|Ga0066381_10195844 | Not Available | 580 | Open in IMG/M |
| 3300005951|Ga0066379_10003735 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 3694 | Open in IMG/M |
| 3300005951|Ga0066379_10143323 | All Organisms → cellular organisms → Archaea | 760 | Open in IMG/M |
| 3300005951|Ga0066379_10276339 | All Organisms → cellular organisms → Archaea | 547 | Open in IMG/M |
| 3300006019|Ga0066375_10050975 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1388 | Open in IMG/M |
| 3300006027|Ga0075462_10238847 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 540 | Open in IMG/M |
| 3300006166|Ga0066836_10031427 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis | 2987 | Open in IMG/M |
| 3300006308|Ga0068470_1283252 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis cloacae | 3641 | Open in IMG/M |
| 3300006308|Ga0068470_1408687 | Not Available | 815 | Open in IMG/M |
| 3300006308|Ga0068470_1726711 | All Organisms → cellular organisms → Archaea | 512 | Open in IMG/M |
| 3300006310|Ga0068471_1110725 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 9611 | Open in IMG/M |
| 3300006310|Ga0068471_1127254 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis | 3353 | Open in IMG/M |
| 3300006310|Ga0068471_1537023 | Not Available | 1734 | Open in IMG/M |
| 3300006313|Ga0068472_10416396 | Not Available | 730 | Open in IMG/M |
| 3300006313|Ga0068472_10416397 | All Organisms → cellular organisms → Archaea | 557 | Open in IMG/M |
| 3300006313|Ga0068472_10507831 | Not Available | 926 | Open in IMG/M |
| 3300006313|Ga0068472_10739426 | Not Available | 593 | Open in IMG/M |
| 3300006315|Ga0068487_1025297 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis | 2500 | Open in IMG/M |
| 3300006316|Ga0068473_1730563 | All Organisms → cellular organisms → Archaea | 828 | Open in IMG/M |
| 3300006316|Ga0068473_1736440 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 625 | Open in IMG/M |
| 3300006325|Ga0068501_1324878 | Not Available | 643 | Open in IMG/M |
| 3300006339|Ga0068481_1428121 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2140 | Open in IMG/M |
| 3300006341|Ga0068493_10469900 | Not Available | 804 | Open in IMG/M |
| 3300006346|Ga0099696_1114956 | Not Available | 875 | Open in IMG/M |
| 3300006414|Ga0099957_1078389 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1627 | Open in IMG/M |
| 3300006414|Ga0099957_1108994 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis | 5296 | Open in IMG/M |
| 3300006414|Ga0099957_1285499 | Not Available | 1158 | Open in IMG/M |
| 3300006421|Ga0082247_10000024 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | 9330 | Open in IMG/M |
| 3300006421|Ga0082247_10283850 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon | 532 | Open in IMG/M |
| 3300006466|Ga0082249_10664789 | All Organisms → cellular organisms → Archaea | 506 | Open in IMG/M |
| 3300006567|Ga0099958_1112613 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 1973 | Open in IMG/M |
| 3300006567|Ga0099958_1250926 | Not Available | 1348 | Open in IMG/M |
| 3300006643|Ga0101445_100304 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | 2663 | Open in IMG/M |
| 3300006872|Ga0101947_1006771 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis cloacae | 6874 | Open in IMG/M |
| 3300006902|Ga0066372_10950265 | Not Available | 524 | Open in IMG/M |
| 3300006958|Ga0101660_100145 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 3684 | Open in IMG/M |
| 3300007283|Ga0066366_10370383 | All Organisms → cellular organisms → Archaea | 618 | Open in IMG/M |
| 3300007291|Ga0066367_1051458 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon | 1456 | Open in IMG/M |
| 3300007760|Ga0105018_1050980 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1677 | Open in IMG/M |
| 3300007778|Ga0102954_1279388 | All Organisms → cellular organisms → Archaea | 507 | Open in IMG/M |
| 3300008223|Ga0105348_1042133 | All Organisms → cellular organisms → Archaea | 1514 | Open in IMG/M |
| 3300008954|Ga0115650_1379913 | All Organisms → cellular organisms → Archaea → TACK group | 622 | Open in IMG/M |
| 3300009030|Ga0114950_10060565 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2987 | Open in IMG/M |
| 3300009030|Ga0114950_10420205 | All Organisms → cellular organisms → Archaea | 1072 | Open in IMG/M |
| 3300009441|Ga0115007_10250477 | All Organisms → cellular organisms → Archaea | 1146 | Open in IMG/M |
| 3300009488|Ga0114925_10296823 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon | 1096 | Open in IMG/M |
| 3300009499|Ga0114930_10457975 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon | 581 | Open in IMG/M |
| 3300009528|Ga0114920_10215057 | All Organisms → cellular organisms → Archaea | 1281 | Open in IMG/M |
| 3300009786|Ga0114999_11083216 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → environmental samples → uncultured marine thaumarchaeote SAT1000_10_G06 | 576 | Open in IMG/M |
| 3300009786|Ga0114999_11349114 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → environmental samples → uncultured marine thaumarchaeote SAT1000_10_G06 | 504 | Open in IMG/M |
| 3300009788|Ga0114923_10165880 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 1576 | Open in IMG/M |
| 3300009788|Ga0114923_10295241 | All Organisms → cellular organisms → Archaea → TACK group | 1179 | Open in IMG/M |
| 3300009788|Ga0114923_10301031 | All Organisms → cellular organisms → Archaea → TACK group | 1167 | Open in IMG/M |
| 3300009788|Ga0114923_11566310 | All Organisms → cellular organisms → Archaea → TACK group | 518 | Open in IMG/M |
| 3300009801|Ga0105056_1036401 | All Organisms → cellular organisms → Archaea → TACK group | 655 | Open in IMG/M |
| 3300009822|Ga0105066_1068920 | All Organisms → cellular organisms → Archaea | 757 | Open in IMG/M |
| 3300010392|Ga0118731_112501760 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 1685 | Open in IMG/M |
| 3300010969|Ga0139246_1112868 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2775 | Open in IMG/M |
| 3300011013|Ga0114934_10119945 | All Organisms → cellular organisms → Archaea | 1263 | Open in IMG/M |
| 3300011256|Ga0151664_1009827 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 9840 | Open in IMG/M |
| 3300012284|Ga0116696_1074700 | Not Available | 631 | Open in IMG/M |
| 3300013116|Ga0171646_1049689 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1912 | Open in IMG/M |
| 3300014872|Ga0180087_1120551 | All Organisms → cellular organisms → Archaea | 501 | Open in IMG/M |
| 3300014873|Ga0180066_1021954 | All Organisms → cellular organisms → Archaea → TACK group | 1177 | Open in IMG/M |
| 3300015256|Ga0180073_1149710 | All Organisms → cellular organisms → Archaea | 504 | Open in IMG/M |
| 3300017768|Ga0187220_1268051 | All Organisms → cellular organisms → Archaea | 510 | Open in IMG/M |
| 3300017949|Ga0181584_10696651 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 607 | Open in IMG/M |
| 3300018031|Ga0184634_10205093 | All Organisms → cellular organisms → Archaea → TACK group | 898 | Open in IMG/M |
| 3300018074|Ga0184640_10340964 | All Organisms → cellular organisms → Archaea → TACK group | 679 | Open in IMG/M |
| 3300018077|Ga0184633_10007400 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 5143 | Open in IMG/M |
| 3300018082|Ga0184639_10019522 | All Organisms → cellular organisms → Archaea | 3372 | Open in IMG/M |
| 3300018426|Ga0181566_11028637 | All Organisms → cellular organisms → Archaea | 554 | Open in IMG/M |
| 3300020175|Ga0206124_10084856 | All Organisms → cellular organisms → Archaea | 1329 | Open in IMG/M |
| 3300020230|Ga0212167_1068854 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2583 | Open in IMG/M |
| 3300020232|Ga0212226_150414 | All Organisms → cellular organisms → Archaea | 2077 | Open in IMG/M |
| 3300020234|Ga0212227_1302815 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2797 | Open in IMG/M |
| 3300020298|Ga0211657_1066149 | Not Available | 700 | Open in IMG/M |
| 3300020347|Ga0211504_1005269 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 4455 | Open in IMG/M |
| 3300020367|Ga0211703_10009106 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis uzonensis | 2180 | Open in IMG/M |
| 3300020376|Ga0211682_10398809 | All Organisms → cellular organisms → Archaea | 500 | Open in IMG/M |
| 3300020389|Ga0211680_10009480 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 5451 | Open in IMG/M |
| 3300020390|Ga0211555_10145259 | Not Available | 881 | Open in IMG/M |
| 3300020399|Ga0211623_10320058 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 553 | Open in IMG/M |
| 3300020407|Ga0211575_10172908 | Not Available | 900 | Open in IMG/M |
| 3300020415|Ga0211553_10399049 | All Organisms → cellular organisms → Archaea | 555 | Open in IMG/M |
| 3300020443|Ga0211544_10353033 | All Organisms → cellular organisms → Archaea | 586 | Open in IMG/M |
| 3300021065|Ga0206686_1110370 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 818 | Open in IMG/M |
| 3300021068|Ga0206684_1007637 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 3923 | Open in IMG/M |
| 3300022201|Ga0224503_10006282 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 3401 | Open in IMG/M |
| 3300022209|Ga0224497_10042130 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 2000 | Open in IMG/M |
| 3300022214|Ga0224505_10272090 | All Organisms → cellular organisms → Archaea | 643 | Open in IMG/M |
| 3300022220|Ga0224513_10163813 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 865 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10279794 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 782 | Open in IMG/M |
| 3300024058|Ga0209997_10574093 | All Organisms → cellular organisms → Archaea | 547 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10322122 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 648 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10025010 | All Organisms → cellular organisms → Archaea | 2145 | Open in IMG/M |
| 3300024265|Ga0209976_10402486 | Not Available | 726 | Open in IMG/M |
| 3300024265|Ga0209976_10653640 | All Organisms → cellular organisms → Archaea → TACK group | 551 | Open in IMG/M |
| (restricted) 3300024299|Ga0233448_1140555 | All Organisms → cellular organisms → Archaea | 627 | Open in IMG/M |
| 3300024353|Ga0209979_1038716 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2422 | Open in IMG/M |
| (restricted) 3300024521|Ga0255056_10155053 | All Organisms → cellular organisms → Archaea | 985 | Open in IMG/M |
| 3300025150|Ga0210057_1354088 | All Organisms → cellular organisms → Archaea | 682 | Open in IMG/M |
| 3300025262|Ga0208060_1024878 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon | 909 | Open in IMG/M |
| 3300025305|Ga0208684_1168581 | Not Available | 503 | Open in IMG/M |
| 3300025322|Ga0209641_10355546 | All Organisms → cellular organisms → Archaea → TACK group | 1066 | Open in IMG/M |
| 3300025323|Ga0209542_10460558 | Not Available | 972 | Open in IMG/M |
| 3300025324|Ga0209640_10963795 | All Organisms → cellular organisms → Archaea | 659 | Open in IMG/M |
| 3300025327|Ga0209751_10152756 | All Organisms → cellular organisms → Archaea → TACK group | 1991 | Open in IMG/M |
| 3300025458|Ga0209559_1095140 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 532 | Open in IMG/M |
| 3300025478|Ga0209576_1091380 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 590 | Open in IMG/M |
| 3300025558|Ga0210139_1022063 | All Organisms → cellular organisms → Archaea → TACK group | 1230 | Open in IMG/M |
| 3300026017|Ga0208001_1012818 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 757 | Open in IMG/M |
| 3300026024|Ga0210130_1018144 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 850 | Open in IMG/M |
| 3300026086|Ga0207964_1125077 | All Organisms → cellular organisms → Archaea | 593 | Open in IMG/M |
| 3300026213|Ga0208131_1004612 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis uzonensis | 3430 | Open in IMG/M |
| 3300026254|Ga0208522_1141536 | All Organisms → cellular organisms → Archaea | 613 | Open in IMG/M |
| 3300026483|Ga0228620_1088368 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 647 | Open in IMG/M |
| 3300027413|Ga0208950_1011470 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | 2887 | Open in IMG/M |
| 3300027779|Ga0209709_10004814 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 10777 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10001237 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 7939 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10356133 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 535 | Open in IMG/M |
| 3300027838|Ga0209089_10092575 | All Organisms → cellular organisms → Archaea | 1875 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10437576 | All Organisms → cellular organisms → Archaea → TACK group | 633 | Open in IMG/M |
| (restricted) 3300027872|Ga0255058_10127201 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 1218 | Open in IMG/M |
| (restricted) 3300027872|Ga0255058_10192476 | All Organisms → cellular organisms → Archaea → TACK group | 978 | Open in IMG/M |
| 3300027957|Ga0209857_1004640 | All Organisms → cellular organisms → Archaea | 2945 | Open in IMG/M |
| 3300028274|Ga0257119_1065278 | All Organisms → cellular organisms → Archaea | 936 | Open in IMG/M |
| 3300028535|Ga0257111_1257446 | All Organisms → cellular organisms → Archaea | 504 | Open in IMG/M |
| 3300028598|Ga0265306_10085698 | All Organisms → cellular organisms → Archaea | 1606 | Open in IMG/M |
| 3300028599|Ga0265309_10006211 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 5665 | Open in IMG/M |
| 3300028600|Ga0265303_10028212 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 3830 | Open in IMG/M |
| 3300028600|Ga0265303_11518720 | All Organisms → cellular organisms → Archaea | 559 | Open in IMG/M |
| 3300031576|Ga0247727_10001158 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis cloacae | 64246 | Open in IMG/M |
| 3300031576|Ga0247727_10020329 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 10167 | Open in IMG/M |
| 3300031576|Ga0247727_10048159 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 5275 | Open in IMG/M |
| 3300031660|Ga0307994_1117134 | All Organisms → cellular organisms → Archaea | 930 | Open in IMG/M |
| 3300031757|Ga0315328_10229912 | All Organisms → cellular organisms → Archaea | 1085 | Open in IMG/M |
| 3300031766|Ga0315322_10221281 | All Organisms → cellular organisms → Archaea | 1320 | Open in IMG/M |
| 3300031773|Ga0315332_10574328 | All Organisms → cellular organisms → Archaea → TACK group | 704 | Open in IMG/M |
| 3300031801|Ga0310121_10012201 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 6643 | Open in IMG/M |
| 3300032018|Ga0315272_10695325 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon CG_4_9_14_0_8_um_filter_34_10 | 517 | Open in IMG/M |
| 3300032173|Ga0315268_10309698 | All Organisms → cellular organisms → Archaea | 1531 | Open in IMG/M |
| 3300032277|Ga0316202_10158707 | All Organisms → cellular organisms → Archaea | 1051 | Open in IMG/M |
| 3300032278|Ga0310345_10209124 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1772 | Open in IMG/M |
| 3300033233|Ga0334722_10000888 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 40875 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 12.81% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.33% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 6.40% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.91% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.93% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 4.43% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 2.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.46% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.46% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.97% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.97% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.97% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.97% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.97% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.48% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.48% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.48% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.48% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 1.48% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.48% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.48% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.48% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.99% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.99% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.99% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine | 0.99% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.99% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.99% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Delisea Pulchra | Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra | 0.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.49% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.49% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.49% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.49% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.49% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.49% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.49% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.49% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.49% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.49% |
| Marine (Brackish) | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine (Brackish) | 0.49% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.49% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.49% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.49% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.49% |
| Hydrothermal Chimney Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Chimney Microbial Mat | 0.49% |
| Marine | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine | 0.49% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents | 0.49% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.49% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.49% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.49% |
| Beach Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand | 0.49% |
| Coelocarteria Singaporensis (Marine Sponge) | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) | 0.49% |
| Drinking Water Pipes | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2061766003 | Hydrothermal vent microbial communities from Guaymas and Carmen Basins, Gulf of California, Sample 457 | Environmental | Open in IMG/M |
| 2088090013 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13Cmethane anaerobic no nitrate | Environmental | Open in IMG/M |
| 2236876008 | Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-3LG-Deep1200 | Environmental | Open in IMG/M |
| 2236876009 | Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-0p8-Hyp-75m | Environmental | Open in IMG/M |
| 2263196002 | April 2009 400 m contigs | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000136 | Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5m | Environmental | Open in IMG/M |
| 3300000141 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1300m | Environmental | Open in IMG/M |
| 3300000142 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500m | Environmental | Open in IMG/M |
| 3300000143 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 10m | Environmental | Open in IMG/M |
| 3300000152 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P12 500m | Environmental | Open in IMG/M |
| 3300000155 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 200m | Environmental | Open in IMG/M |
| 3300000157 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 1000m | Environmental | Open in IMG/M |
| 3300000164 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 200m | Environmental | Open in IMG/M |
| 3300000170 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 135m | Environmental | Open in IMG/M |
| 3300000179 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 500m | Environmental | Open in IMG/M |
| 3300000186 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2010 P16 2000m | Environmental | Open in IMG/M |
| 3300000222 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m | Environmental | Open in IMG/M |
| 3300000238 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 100m | Environmental | Open in IMG/M |
| 3300000254 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100m | Environmental | Open in IMG/M |
| 3300000256 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - ample_F_10_SI03_120 | Environmental | Open in IMG/M |
| 3300000259 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_J_08_P26_500 | Environmental | Open in IMG/M |
| 3300000323 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P20 2000m | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000950 | Marine microbial communities from the Deep Atlantic Ocean - MP0441 | Environmental | Open in IMG/M |
| 3300001073 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 | Environmental | Open in IMG/M |
| 3300001133 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 | Environmental | Open in IMG/M |
| 3300001380 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m | Environmental | Open in IMG/M |
| 3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
| 3300001771 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Beebe Sites | Environmental | Open in IMG/M |
| 3300001959 | Mangrove swamp microbial communities from Isabella Island, Equador - GS032 | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002036 | Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_B3 | Host-Associated | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002965 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - NADW_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003153 | Marine microbial communities from deep-sea hydrothermal vent plumes in the Guaymas Basin | Environmental | Open in IMG/M |
| 3300004150 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004213 | Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NA | Environmental | Open in IMG/M |
| 3300004278 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_150m | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005592 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV89 | Environmental | Open in IMG/M |
| 3300005593 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005945 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B | Environmental | Open in IMG/M |
| 3300005951 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006316 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006346 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0770m | Environmental | Open in IMG/M |
| 3300006414 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0500m | Environmental | Open in IMG/M |
| 3300006421 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten I | Environmental | Open in IMG/M |
| 3300006466 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten VI | Environmental | Open in IMG/M |
| 3300006567 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770m | Environmental | Open in IMG/M |
| 3300006643 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ11 time point | Environmental | Open in IMG/M |
| 3300006872 | Biofilm microbial communities from drinking water pipes in Singapore | Engineered | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006958 | Marine sponge C. singaporensis. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', co31is | Host-Associated | Open in IMG/M |
| 3300007283 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B | Environmental | Open in IMG/M |
| 3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300007760 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300008223 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN8C Hudson Canyon | Environmental | Open in IMG/M |
| 3300008954 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
| 3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009788 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010969 | Microbial communities from the outside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.out | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011256 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, total | Environmental | Open in IMG/M |
| 3300012284 | Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S2 | Environmental | Open in IMG/M |
| 3300013116 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020230 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR02 | Environmental | Open in IMG/M |
| 3300020232 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR05 | Environmental | Open in IMG/M |
| 3300020234 | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N074 | Environmental | Open in IMG/M |
| 3300020298 | Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX556051-ERR599128) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020390 | Marine microbial communities from Tara Oceans - TARA_B100002049 (ERX555953-ERR598985) | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300020407 | Marine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115) | Environmental | Open in IMG/M |
| 3300020415 | Marine microbial communities from Tara Oceans - TARA_B100001146 (ERX555973-ERR599166) | Environmental | Open in IMG/M |
| 3300020443 | Marine microbial communities from Tara Oceans - TARA_B100001179 (ERX556000-ERR598944) | Environmental | Open in IMG/M |
| 3300021065 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022209 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024058 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024265 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024299 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_150_MG | Environmental | Open in IMG/M |
| 3300024353 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300025150 | Groundwater microbial communities from aquifer - Crystal Geyser CG10_big_fil_rev_8/21/14_0.10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025262 | Marine microbial communities from the Deep Indian Ocean - MP0901 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025323 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank highO2_0.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025458 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_110m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_135m (SPAdes) | Environmental | Open in IMG/M |
| 3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026017 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026086 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026213 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 (SPAdes) | Environmental | Open in IMG/M |
| 3300026254 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 (SPAdes) | Environmental | Open in IMG/M |
| 3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027872 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9 | Environmental | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028274 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_200m | Environmental | Open in IMG/M |
| 3300028535 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500m | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031660 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GB_4MN_02679630 | 2061766003 | Hydrothermal Vents | ILYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK |
| LWAnNN_05157640 | 2088090013 | Freshwater Sediment | TIPYYMIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK |
| none_5431672 | 2236876008 | Marine Estuarine | TVP*YMIRCKYCTKNFIESMNGLTERTFHEILHEPEIVNQ |
| none_0856541 | 2236876009 | Marine Estuarine | TIQYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK |
| LD2009400mD_027822 | 2263196002 | Marine (Brackish) | MIQCEYCPRGFIETVNGLAEKTFHELLHEPTVVNK |
| DelMOWin2010_100652782 | 3300000117 | Marine | MIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK* |
| KGI_S1_ANT02_95mDRAFT_100384042 | 3300000136 | Marine | MIQCEYCPRGFIETVNGLAEKTFHELLHEPTVVNK* |
| LPjun08P41300mDRAFT_10074801 | 3300000141 | Marine | GTVLYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK* |
| LPjun08P41300mDRAFT_10457532 | 3300000141 | Marine | TVQYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK* |
| LPaug09P16500mDRAFT_10408962 | 3300000142 | Marine | TVP*YMIQCKYCTKNFIESMNGLTERTFHEILHEPKIVNQ* |
| LPaug09P16500mDRAFT_10664951 | 3300000142 | Marine | TVP*YMIRCKYCTKNFIESMNGLTERTFHEILHEPKIVNQ* |
| SI53jan11_10mDRAFT_1012632 | 3300000143 | Marine | MIQCEYCPRGFIETTTGLAEKTFHELLHEPEVVNK* |
| LPjun08P12500mDRAFT_10434482 | 3300000152 | Marine | MIQCEYCAKNFMESMNGLAEKTFHEMLHTPEIVNQ* |
| SI36aug09_200mDRAFT_10137201 | 3300000155 | Marine | TILYYMIQCEFCTRGFIETANGLAEKTFHELLHEPTIVNK* |
| LPaug08P261000mDRAFT_10482462 | 3300000157 | Marine | MIQCDYCTKSFVESMNGLAEKTFHEILHAPKIVNQ* |
| SI39no09_200mDRAFT_10517521 | 3300000164 | Marine | TVQYYMIQCEYCPRGFIETTTGLAEKTFHELLHEPEVVNK* |
| SI36aug09_135mDRAFT_10294131 | 3300000170 | Marine | CMIQCEYCTRGFIETHNGLAEKTFHELLHEPTVVNK* |
| LPjun09P16500mDRAFT_10483792 | 3300000179 | Marine | YYMIQCDYCTRNFVENMNGLAEKTFHEMLHEPEVVNQ* |
| LPfeb10P162000mDRAFT_10043602 | 3300000186 | Marine | MIQCEYCDKNFIESMNGLAEKTFHEMLHAPEIVNQ* |
| LPjun09P12500mDRAFT_10241662 | 3300000222 | Marine | MIQCEYCPRGFIXTTNGLAEKTFHELLHEPEVVNK* |
| LPjun09P12500mDRAFT_10724562 | 3300000222 | Marine | MIQCEFCTRGFIETVNGLAEKTFHELLHEPIVVNK* |
| SI36aug09_100mDRAFT_10448672 | 3300000238 | Marine | MIQCEFCTRGFIETANGLAEKTFHELLHEPTIVNK* |
| SI34jun09_100mDRAFT_10023837 | 3300000254 | Marine | YYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK* |
| LP_F_10_SI03_120DRAFT_10177012 | 3300000256 | Marine | MIQCEYCPRGFIETTNGLAEKTFHEXLHEPEVVNK* |
| LP_J_08_P26_500DRAFT_10065481 | 3300000259 | Marine | MLECEYCEQHFIETRNGLVEKTFHELLHDPETVNK* |
| LPaug09P202000mDRAFT_10172392 | 3300000323 | Marine | YGTVLYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK* |
| JGI1357J11328_1000023243 | 3300000574 | Groundwater | MIQCEYCPRGFIDTAIGLAEKTFHELLHEPEVVNK* |
| JGI11881J13070_10040651 | 3300000950 | Deep Ocean | YGTIPYYMIQCEFCTRGFIDTANGLAEKTFHELLHEPRVVNK* |
| C687J13245_1000924 | 3300001073 | Soil | IVCEYCPEKFVENMNGLVEKTFHELLHEPEMVNK* |
| C687J13250_1003542 | 3300001133 | Soil | MIVCEYCPEKFVENMNGLVEKTFHELLHEPEMVNK* |
| JGI1356J14229_101640122 | 3300001380 | Groundwater | YGTIPYYMIQCEYCPRGFIDTAIGLAEKTFHELLHEPEVVNK* |
| GBIDBA_100607353 | 3300001683 | Hydrothermal Vent Plume | MIQCEYCPRGFIDTTNGLAEKTFHELLHEPEVVNK* |
| Beebe_10510691 | 3300001771 | Hydrothermal Vent Plume | IQCEYCDKNFIESMNGLAEKTFHEMLHAPEIVNQ* |
| GOS2247_10661192 | 3300001959 | Marine | MIQCEYCTRGFIETANGLAEKTFHELLHAPEVVNK* |
| GOS2236_10032892 | 3300001968 | Marine | DMITCEYCTKQFVESMTGLTEKTLHEILHGPELVNE* |
| BIB32012_101175131 | 3300002036 | Delisea Pulchra | MIQCEYCTRGFVDTANGLVAKTFHELLHEPDVVNK* |
| BIB32012_101359702 | 3300002036 | Delisea Pulchra | MIECEYCPREFIETANGLAEKTFHELLHEPEVVNK* |
| KVRMV2_1001213742 | 3300002231 | Marine Sediment | MIQCEYCPKGFIETANGLAEKTFHELLHEPNVVNK* |
| KVRMV2_1019274791 | 3300002231 | Marine Sediment | MIACEYCPEKFIENMNGLAEKTFHELLHEPKMVNK* |
| JGI26063J44948_10529031 | 3300002965 | Marine | VLYYMIQCEYCPRGFIDTTNGLAEKTFHELLHEPEVVNK* |
| Ga0052192_10010335 | 3300003153 | Marine | ILYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK* |
| Ga0055520_101660881 | 3300004150 | Natural And Restored Wetlands | IPYYMIQCDYCPRGFIETANGLAEKTFHELLHEPEVVNK* |
| Ga0066648_106606881 | 3300004213 | Groundwater | TQALIVGTIPYYMIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK* |
| Ga0066609_100574461 | 3300004278 | Marine | YGTVQYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK* |
| Ga0066851_100661261 | 3300005427 | Marine | VLYYMIQCEYCERGFIETINGLAEKTFHEIICSPEVSNK* |
| Ga0070729_104147852 | 3300005589 | Marine Sediment | MIQCEYCPRGFIETVNGLAEKTFHELLHEPEVVNK* |
| Ga0070727_100266832 | 3300005590 | Marine Sediment | MIQCEFCPQGFIETANGLAEKTFHELLHEPNVVNK* |
| Ga0066838_101020332 | 3300005592 | Marine | MIQCEYCSRGFVDTMNGLAEKTFHEVLHAPKIVNQ* |
| Ga0066837_1000083920 | 3300005593 | Marine | MIECTYCKRGFVESMNGLAEKTFHELLHEPETVNN* |
| Ga0066837_101039031 | 3300005593 | Marine | MLQCEYCERGFIETHNGLAEKTIHEMLHEPETVNK* |
| Ga0070726_101787442 | 3300005600 | Marine Sediment | MIQCEYCPRGFIETANGLAEKTFHELLHEPEVVNK* |
| Ga0070722_100058852 | 3300005601 | Marine Sediment | MIQCEYCPQGFIDTANGLAEKTFHELLHEPEVVNK* |
| Ga0070722_100207192 | 3300005601 | Marine Sediment | MIECEYCPRGFIETANGLAEKTFHELLHEPEVVNK* |
| Ga0074476_13955902 | 3300005825 | Sediment (Intertidal) | MIQCDYCPRGFIETANGLAEKTFHELLHEPEVVNK* |
| Ga0074475_109751992 | 3300005828 | Sediment (Intertidal) | AINSTTIPYYMIQCDYCPRGFIETANGLAEKTFHELLHEPEVVNK* |
| Ga0074479_100904024 | 3300005829 | Sediment (Intertidal) | MIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK* |
| Ga0074479_1076791148 | 3300005829 | Sediment (Intertidal) | MITCEYCTKQFVESLTGLTEKTFHEILHDPKMVNE* |
| Ga0066381_101565081 | 3300005945 | Marine | MIRCKYCTKNFIESMNGLTERTFHEILHEPKIVNQ* |
| Ga0066381_101958442 | 3300005945 | Marine | YMIQCNYCTKSFIESMNGLAEKTFHEILHKPEIVNQ* |
| Ga0066379_100037353 | 3300005951 | Marine | MIECTYCKRGFVESMNGLAEKTFHELLHEPKTVNN* |
| Ga0066379_101433232 | 3300005951 | Marine | MIKCNYCPKGFVENMNGLAEKTFHEILHEPEIVNQ* |
| Ga0066379_102763392 | 3300005951 | Marine | MLECEYCQQHFVENRNGLAEKTFHEILHDPEIINN* |
| Ga0066375_100509752 | 3300006019 | Marine | MIQCEFCTRGFIDTANGLAEKTFHELLHEPQVVNK* |
| Ga0075462_102388471 | 3300006027 | Aqueous | MIQCEYCARGFIETTNGLAEKTFHELLHEPEVVNK* |
| Ga0066836_100314272 | 3300006166 | Marine | MLECEYCEQHFIENRNGLAEKTFHELLHDPETVNK* |
| Ga0068470_12832522 | 3300006308 | Marine | MIQCEYCAKNFMESMNGLAEKTFHEMLHAPEIVNQ* |
| Ga0068470_14086871 | 3300006308 | Marine | MIQCDYCAKNFVVNMNGLAEKTFHEMLHEPEIVNQ |
| Ga0068470_17267111 | 3300006308 | Marine | HMIQCEYCTRSFVESMNGLAEKTFHEILHEPEIVNQ* |
| Ga0068471_111072510 | 3300006310 | Marine | MIQCEYCTENFIESMNGLAEKTFHEMLHAPEIVNQ* |
| Ga0068471_11272541 | 3300006310 | Marine | MIQCDYCTKNFVENMNGLAEKTFHEMLHEPEIVNH |
| Ga0068471_15370232 | 3300006310 | Marine | MIQCEYCAKNFIESMNGLAEKTFHEMLHAPEIVNQ* |
| Ga0068472_104163961 | 3300006313 | Marine | MIQCEYCTKNFVENMNGLAEKTFHEMLHEPKIVNQ* |
| Ga0068472_104163972 | 3300006313 | Marine | MIECEYCTKNFVESMNGLAEKTFHEMLHEPKIVNQ* |
| Ga0068472_105078312 | 3300006313 | Marine | MIQCEYCAKNFIESMNGLAEKTFHEILHAPEIVNQ* |
| Ga0068472_107394262 | 3300006313 | Marine | VPYYMIQCDYCTRNFVENMNGLAEKTFHEMLHEPEVVNQ* |
| Ga0068487_10252973 | 3300006315 | Marine | MLECQYCSQHFVENRNGLAEKTFHEILHDPEIINN* |
| Ga0068473_17305631 | 3300006316 | Marine | YMIQCEYCTKSFVESMNGLAEKTFHEVLHEPEIVNQ* |
| Ga0068473_17364403 | 3300006316 | Marine | IECEYCTKNFVESMNGLAEKTFHEMLHEPEIVNQ* |
| Ga0068501_13248781 | 3300006325 | Marine | MIQSEYCTKNFVESMNGLIEKTFHILLHEPRIVNQ*YP |
| Ga0068481_14281212 | 3300006339 | Marine | MIQCEYCTKNFIESMNGLAEKTFHEMLHAPEIVNQ* |
| Ga0068493_104699002 | 3300006341 | Marine | MIQCEYCAKNFVENMNGLAEKTFHEMLHEPKIVNQ* |
| Ga0099696_11149561 | 3300006346 | Marine | IQCEYCTKSFVESMNGLAEKTFHEVLHEPEIVNQ* |
| Ga0099957_10783892 | 3300006414 | Marine | MIQCEYCAKNFIESMNGLAEKTFHEMLHTPEIVNQ* |
| Ga0099957_110899410 | 3300006414 | Marine | MIQCEYCTKSFVESMNGLAEKTFHEVLHEPEIVNQ* |
| Ga0099957_12854992 | 3300006414 | Marine | MIQCEYCSRSFVDTMNGLAEKTFHEVLHAPKIVNQ* |
| Ga0082247_100000242 | 3300006421 | Sediment | MIQCEYCPRGFIETSNGLAEKTFHELLHEPNVVNK* |
| Ga0082247_102838502 | 3300006421 | Sediment | YGTIPYYMIQCEFCPKGFIETHNGLAEKTFHELLHEPNVVNK* |
| Ga0082249_106647892 | 3300006466 | Sediment | MIQCEYCPKGFIETHNGLAEKTFHELLHEPEMVNR* |
| Ga0099958_11126132 | 3300006567 | Marine | MIECEYCTKNFVESMNGLAEKTFHEMLHEPEIVNQ* |
| Ga0099958_12509262 | 3300006567 | Marine | MIECEYCTKNFVENMNGLAEKTFHEMLHEPKIVNQ* |
| Ga0101445_1003042 | 3300006643 | Marine Surface Water | MIQCEYCTRGFIETTNGLAEKTFHELLHEPEVVNK* |
| Ga0101947_10067714 | 3300006872 | Drinking Water Pipes | MITCEYCTKQFVESMNGLTEKTLHEILHGPELVNE* |
| Ga0066372_109502652 | 3300006902 | Marine | MIQCEYCSKGFVDTMNGLAEKTFHEVLHAPKIVNQ* |
| Ga0101660_1001452 | 3300006958 | Coelocarteria Singaporensis (Marine Sponge) | MIQCEYCTKGFIETANGLAEKTFHELLHGAKVVNK* |
| Ga0066366_103703832 | 3300007283 | Marine | IECTYCKRGFVESMNGLAEKTFHELLHEPATVNN* |
| Ga0066367_10514581 | 3300007291 | Marine | IQCEYCNKNFIASMNGLAEKTFHEILHAPEIVNQ* |
| Ga0105018_10509801 | 3300007760 | Marine | TMLQCEYCERGFIETHNGLAEKTMHEMLHEPETVNK* |
| Ga0102954_12793881 | 3300007778 | Water | MIQCEYCPRGFIDTANGLVAKTFHELLHEPEVVNK* |
| Ga0105348_10421331 | 3300008223 | Methane Seep Mesocosm | MIQCEYCPRGFVETTNGLAEKTFHELLHEPEVVNK* |
| Ga0115650_13799131 | 3300008954 | Marine | TVTMLQCEYCERGFIETHNGLAEKTMHEMLHEPETVNK* |
| Ga0114950_100605653 | 3300009030 | Deep Subsurface | MIQCEYCTRGFIETMNGLAEKTFHELLHEPRVVNK* |
| Ga0114950_104202052 | 3300009030 | Deep Subsurface | MIECEYCPRGFIETANGLAEKTIHELLHEPQVVNK* |
| Ga0115007_102504771 | 3300009441 | Marine | MIQCEYCPRGFIETTNGLAEKTFHELLHDPEVVNK* |
| Ga0114925_102968232 | 3300009488 | Deep Subsurface | IQCEFCPQGFIETANGLAEKTFHELLHEPNVVNK* |
| Ga0114930_104579751 | 3300009499 | Deep Subsurface | YMIQCEYCPMGFIETANGLAEKTFHELLPAPNVVNK* |
| Ga0114920_102150572 | 3300009528 | Deep Subsurface | MIACEYCPEKFIENMNGLVEKTFHELLHEPEMVNK* |
| Ga0114999_110832161 | 3300009786 | Marine | MIQCEYCPRGFIETATGLAEKTFHELLHEPEVVNK* |
| Ga0114999_113491141 | 3300009786 | Marine | MIQCEYCPRGFIDTTTGLAEKTFHELLHEPEVVNK* |
| Ga0114923_101658802 | 3300009788 | Deep Subsurface | MIACEYCPEKFIENMNGLVEKTFHELLHEPEMVNE* |
| Ga0114923_102952412 | 3300009788 | Deep Subsurface | TMIICEYCPEKFIENMNGLVEKTFHELLHEPAMVNK* |
| Ga0114923_103010311 | 3300009788 | Deep Subsurface | IACEYCPEKFIENMNGLVEKTFHELLHEPEMVNE* |
| Ga0114923_115663102 | 3300009788 | Deep Subsurface | MIICEYCPEKFIENMNGLVEKTFHELLHEPEMVNK* |
| Ga0105056_10364011 | 3300009801 | Groundwater Sand | NFMITCEFCPERFIESMNGLVEKTFHELLHEPEMVNK* |
| Ga0105066_10689201 | 3300009822 | Groundwater Sand | MIVCEYCPERFIENMNGLVEKTFHELLHEPEMVNK* |
| Ga0118731_1125017601 | 3300010392 | Marine | IPYYMIECEYCPRGFIETANGLAEKTFHELLHEPEVVNK* |
| Ga0139246_11128683 | 3300010969 | Hydrothermal Chimney Microbial Mat | MVPYYMIQCEYCPRGFIETANGLAEKTFHELLHEPEVVNK* |
| Ga0114934_101199452 | 3300011013 | Deep Subsurface | IWYGTIRYYMIECTYCKRGFVESMNGLAEKTFHELLHEPKTVNN* |
| Ga0151664_10098278 | 3300011256 | Marine | MIQCEYCPRGFIETVNGLAEKTFHELLHEPDVVNK* |
| Ga0116696_10747002 | 3300012284 | Beach Sand | MIQCEYCQRGFVESSNGLTEKIFHELLHEPEVVNH* |
| Ga0171646_10496892 | 3300013116 | Marine | MLECEYCSQHFVENRNGLAEKTFHEILHDPEIINN* |
| Ga0180087_11205511 | 3300014872 | Soil | MITCEYCPEKFVENMNGLVVKTFHELLHEPEMVNK* |
| Ga0180066_10219541 | 3300014873 | Soil | MIVCEYCPEKFVENMNGLVVKTFHELLHEPEIVNK* |
| Ga0180073_11497101 | 3300015256 | Soil | MITCEYCPEKFVENMNGLVVKTFHELLHEPEIVNK* |
| Ga0187220_12680511 | 3300017768 | Seawater | MIQCEYCARGFIETSNGLAEKTFHELLHEPEVVNK |
| Ga0181584_106966512 | 3300017949 | Salt Marsh | MIQCEYCPRGFIETANGLAEKTFHELLHEPEVVNK |
| Ga0184634_102050932 | 3300018031 | Groundwater Sediment | MIVCEYCPEKFIESMNGLVEKTFHELLHAPEMVNK |
| Ga0184640_103409641 | 3300018074 | Groundwater Sediment | MIVCEYCPEKFVENMNGLVVKTFHELLHEPEIVNK |
| Ga0184633_100074004 | 3300018077 | Groundwater Sediment | MIVCEYCPEKFVENMNGLVVKTFHELLHEPEMVNK |
| Ga0184639_100195225 | 3300018082 | Groundwater Sediment | MIVCEYCPEKFIESMNGLVEKTFHELLHEPEMVNK |
| Ga0181566_110286371 | 3300018426 | Salt Marsh | MLQCEYCPRGFIETANGLAEKTFHELIHEPEVVNK |
| Ga0206124_100848562 | 3300020175 | Seawater | MIQCEYCARGFIETTNGLAEKTFHELLHEPEVVNK |
| Ga0212167_10688543 | 3300020230 | Sediment | MIECEYCPRGFIETANGLAEKTIHELLHEPQVVNK |
| Ga0212226_1504142 | 3300020232 | Sediment | MIQCEYCPKGFIETVNGLAEKTFHELLHEPRVVNK |
| Ga0212227_13028153 | 3300020234 | Sediment | MIQCEYCPKGFIETHNGLAEKTFHELLHEPEMVNR |
| Ga0211657_10661491 | 3300020298 | Marine | MIRCKYCTKNFIESMNGLTERTFHEILHEPEIVNQ |
| Ga0211504_10052696 | 3300020347 | Marine | MIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK |
| Ga0211703_100091063 | 3300020367 | Marine | MIQCEYCDKNFIESMNGLAEKTFHEMLHAPEIVNQ |
| Ga0211682_103988091 | 3300020376 | Marine | MIQCEYCPRGFIETTTGLAEKTFHELLHEPEVVNK |
| Ga0211680_100094802 | 3300020389 | Marine | MIQCEYCPRGFIDTTNGLAEKTFHELLHEPEVVNK |
| Ga0211555_101452591 | 3300020390 | Marine | MIQCEYCSKNFVESMNGLAEKTFHEMLHAPEIVNQ |
| Ga0211623_103200582 | 3300020399 | Marine | MIQCEYCPRGFVETTNGLAEKTFHELLHEPEVVNK |
| Ga0211575_101729081 | 3300020407 | Marine | YMIQCDYCTKSFVENMNGLAEKTFHEMLHEPEIVNQ |
| Ga0211553_103990492 | 3300020415 | Marine | MIQCDYCTKSFVESMNGLAEKTFHEILHEPEIVNQ |
| Ga0211544_103530331 | 3300020443 | Marine | MLECEYCEQYFIESRNGLAEKTFHELLHDPETVNK |
| Ga0206686_11103702 | 3300021065 | Seawater | LYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK |
| Ga0206684_10076373 | 3300021068 | Seawater | YYMIQCEFCTRGFIETVNGLAEKTFHELLHEPIVVNK |
| Ga0224503_100062823 | 3300022201 | Sediment | MIQCEYCPRGFIDTANGLVAKTFHELLHEPEVVNK |
| Ga0224497_100421302 | 3300022209 | Sediment | MVPYYMIQCEYCPKGFIETANGLAEKTFHELLHEPEVVNK |
| Ga0224505_102720901 | 3300022214 | Sediment | CMIQCEYCPRGFIETSNGLAEKTFHELLHEPEVVNK |
| Ga0224513_101638132 | 3300022220 | Sediment | MIECEYCPRGFIETANGLAEKTFHELLHEPEVVNK |
| (restricted) Ga0233432_102797942 | 3300023109 | Seawater | VQYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK |
| Ga0209997_105740932 | 3300024058 | Deep Subsurface | MIRCEYCPKGFVESHNGLVEKTFHELLHEPEMINR |
| (restricted) Ga0255040_103221221 | 3300024059 | Seawater | YGTIPYYMIQCEYCPKGFIETANGLAEKTFHELLHEPRVVNK |
| (restricted) Ga0255039_100250102 | 3300024062 | Seawater | MIQCEYCPRGFIETVNGLAEKTFHELLHEPEVVNK |
| Ga0209976_104024862 | 3300024265 | Deep Subsurface | MIACEYCPEKFIENMNGLVEKTFHELLHEPEMVNE |
| Ga0209976_106536402 | 3300024265 | Deep Subsurface | YWYRNNMIICEYCPEKFIENMNGLVEKTFHELLHEPEMVNK |
| (restricted) Ga0233448_11405551 | 3300024299 | Seawater | MIQCEFCTRGFIETVNGLAEKTFHELLHEPTIVNK |
| Ga0209979_10387161 | 3300024353 | Deep Subsurface | YMIQCEFCPMGFIETANGLAEKTFHELLHEPNVVNK |
| (restricted) Ga0255056_101550532 | 3300024521 | Seawater | MIQCEYCPKGFIETTNGLAEKTFHELLHEPETVNK |
| Ga0210057_13540882 | 3300025150 | Groundwater | MIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK |
| Ga0208060_10248783 | 3300025262 | Deep Ocean | YMIECEYCTKNFVESMNGLAEKTFHEMLHEPEIVNQ |
| Ga0208684_11685811 | 3300025305 | Deep Ocean | MIQCEYCSRNFVESMNGLVEKTFHILLHEPEIVNQ |
| Ga0209641_103555461 | 3300025322 | Soil | MITCEYCPEKFVENMNGLVVKTFHELLHEPEMVNK |
| Ga0209542_104605582 | 3300025323 | Soil | TTMITCEYCPRGFVESPNGLVEKTLHEVLHSPEVVNK |
| Ga0209640_109637952 | 3300025324 | Soil | PYHMIQCEYCPRGFIDTAIGLAEKTFHELLHEPEVVNK |
| Ga0209751_101527563 | 3300025327 | Soil | MIVCEYCPEKFVENMNGLVEKTFHELLHEPEMVTIPLPDY |
| Ga0209559_10951401 | 3300025458 | Marine | VLYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK |
| Ga0209576_10913802 | 3300025478 | Marine | GTVQYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK |
| Ga0210139_10220632 | 3300025558 | Natural And Restored Wetlands | MINCEYCPEKFIESMNGLVEKTFHELLHEPEMVNE |
| Ga0208001_10128181 | 3300026017 | Natural And Restored Wetlands | VPYNMIQCEYCPRGFIETANGLAEKTFHELLHEPEVVNK |
| Ga0210130_10181441 | 3300026024 | Natural And Restored Wetlands | IPYYMIQCDYCPRGFIETANGLAEKTFHELLHEPEVVNK |
| Ga0207964_11250772 | 3300026086 | Marine | MIKCNYCPKGFVENMNGLAEKTFHEILHEPEIVNQ |
| Ga0208131_10046124 | 3300026213 | Marine | YMIQCEYCDKNFIESMNGLAEKTFHEMLHAPEIVNQ |
| Ga0208522_11415362 | 3300026254 | Marine | MIECTYCKRGFVESMNGLAEKTFHELLHEPKTVNN |
| Ga0228620_10883682 | 3300026483 | Seawater | VLYYMIQCEYCARGFIETSNGLAEKTFHELLHEPEVVNK |
| Ga0208950_10114703 | 3300027413 | Marine | QYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK |
| Ga0209709_100048141 | 3300027779 | Marine | YGTILYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK |
| (restricted) Ga0233416_1000123710 | 3300027799 | Sediment | MITCEYCPERFIESMNGLVEKTFHELLHEPEMVNK |
| (restricted) Ga0255041_103561332 | 3300027837 | Seawater | MIQCEYCPKGFIETANGLAEKTFHELLHEPRVVNK |
| Ga0209089_100925751 | 3300027838 | Marine | MIQCEYCPRGFIDTTTGLAEKTFHELLHEPEVVNK |
| (restricted) Ga0255053_104375762 | 3300027868 | Seawater | MIVCEYCPEKFIENMNGLVEKTFHELLHEPKMVNE |
| (restricted) Ga0255058_101272012 | 3300027872 | Seawater | MIACEYCPEKFIENMNGLVEKTFHELLHAPEMVNE |
| (restricted) Ga0255058_101924761 | 3300027872 | Seawater | YRNLMITCEYCKERFVENMNGLAEKTFHELLHDPKMVNN |
| Ga0209857_10046402 | 3300027957 | Groundwater Sand | MIVCEYCPERFIENMNGLVEKTFHELLHEPEMVNK |
| Ga0257119_10652782 | 3300028274 | Marine | YMIQCEFCTRGFIETANGLAEKTFHELLHEPTIVNK |
| Ga0257111_12574461 | 3300028535 | Marine | MIKCNYCTKGFIESMNGLAEKTFHEILHKPEIVNQ |
| Ga0265306_100856981 | 3300028598 | Sediment | MIQCEYCPRGFVDTANGLVAKTFHELLHEPEVVNK |
| Ga0265309_100062111 | 3300028599 | Sediment | TIPYYMIQCEYCPRGFIETVNGLAEKTFHELLHEPEVVNK |
| Ga0265303_100282121 | 3300028600 | Sediment | YGTIPYYMIQCEYCPRGFIETVNGLAEKTFHELLHEPEVVNK |
| Ga0265303_115187201 | 3300028600 | Sediment | TIPYCMIQCEYCPRGFVDTANGLVAKTFHELLHEPEVVNK |
| Ga0247727_1000115836 | 3300031576 | Biofilm | MVPYHMIHCEYCPRQFVESRSGLTEKTLHEILHGPELVNE |
| Ga0247727_100203299 | 3300031576 | Biofilm | MITCDYCPEKFVENMNGLVVKTFHELLHEPEMVNK |
| Ga0247727_100481593 | 3300031576 | Biofilm | MITCEYCPEKFVESMNGLVVKTFHELLHEPEMVNK |
| Ga0307994_11171341 | 3300031660 | Marine | QYYMIQCEYCPRGFIETTTGLAEKTFHELLHEPEVVNK |
| Ga0315328_102299122 | 3300031757 | Seawater | YMLECEYCEQHFIETRNGLVEKTFHELLHDPETVNK |
| Ga0315322_102212811 | 3300031766 | Seawater | IQYYMLECEYCEQHFIETRNGLAEKTFHELLHDPETVNK |
| Ga0315332_105743282 | 3300031773 | Seawater | MLECEYCEQYFIENRNGLAEKTFHELLHDPETVNK |
| Ga0310121_100122012 | 3300031801 | Marine | MIQCEYCSRGFVDTMNGLAEKTFHEVLHAPKIVNQ |
| Ga0315272_106953251 | 3300032018 | Sediment | IPYHMIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK |
| Ga0315268_103096981 | 3300032173 | Sediment | GTIPYLMIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK |
| Ga0316202_101587072 | 3300032277 | Microbial Mat | MIQCEYCPRGFVDTANGLVAKTFHELLHEPDVVNK |
| Ga0310345_102091243 | 3300032278 | Seawater | MIQCEYCDKNFIESMNGLAEKTFHEMLHTPEIVNQ |
| Ga0334722_1000088824 | 3300033233 | Sediment | MIVCEYCPEKFVENMNGLVEKTFHELLHEPEMVNK |
| ⦗Top⦘ |