NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000143

3300000143: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 10m



Overview

Basic Information
IMG/M Taxon OID3300000143 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046785 | Gp0053421 | Ga0026198
Sample NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 10m
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size13836185
Sequencing Scaffolds3
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Funariidae → Funariales → Funariaceae → Physcomitrium → Physcomitrium patens1
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal inletsea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSaanich Inlet 53, Vancouver Island, BC, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)N/ADepth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015265Metagenome / Metatranscriptome256Y
F025141Metagenome / Metatranscriptome203Y
F031720Metagenome182N
F093220Metagenome / Metatranscriptome106N
F103879Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
SI53jan11_10mDRAFT_c100064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Funariidae → Funariales → Funariaceae → Physcomitrium → Physcomitrium patens5824Open in IMG/M
SI53jan11_10mDRAFT_c101263All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1349Open in IMG/M
SI53jan11_10mDRAFT_c103736All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus658Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
SI53jan11_10mDRAFT_c100064SI53jan11_10mDRAFT_1000641F103879INVVLSTQMTEMNPLPFTKETVYHANAATLVTWGIFDLLSEIAFFKQTNRKLQGTSEIILGMETCYDTYAHEFAEQLGDRFSPLGWDSQLERVQAGIDQVNPESRLMTHFRRLTQKNKETVGVGKSWVQVTQSGLSRIVESRGDLKRDRQREARFSLRNWSYRQEFALARRTLYWRERGQMRFHSSQYNMMNVTSIDHNQNSRLTRLYFRDMLIESRQKRALRVSIEPTIYDTFATRKLVVRARKPVAEASQLLAGDLLHVWFDWAKTYSNL*
SI53jan11_10mDRAFT_c101263SI53jan11_10mDRAFT_1012632F025141MIQCEYCPRGFIETTTGLAEKTFHELLHEPEVVNK*
SI53jan11_10mDRAFT_c102057SI53jan11_10mDRAFT_1020571F031720KMNISLNTVLTEAYEISSGLQERLEGIYPIKCNLNFSGLPAMSLCLDHREQRLKSSASKNPQFTLIIDSNTTWNLLKEQTIPSDKIEGXSELALMFLIILAESNIDLELLIYKNFGTVPGLIIRKILSQDFLNDNQKAENIRVRSLQTSLRNISIRMDRMEQKQAL*
SI53jan11_10mDRAFT_c103448SI53jan11_10mDRAFT_1034483F093220SNVKIDRMQENLNIIDKNVRVLEKIVDTAENNLIAAINNACNVKTN*
SI53jan11_10mDRAFT_c103736SI53jan11_10mDRAFT_1037361F015265MYPDHMTKNPKLIETNAIVNLNNVGLPVFLNPIYAIIPMASPTKNPTRFSIFSNKNSNGV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.