| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002036 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0103015 | Gp0060496 | Ga0016875 |
| Sample Name | Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_B3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 713039852 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Bare Island, Sydney, Australia | |||||||
| Coordinates | Lat. (o) | -33.59 | Long. (o) | 151.13 | Alt. (m) | N/A | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000532 | Metagenome / Metatranscriptome | 1046 | Y |
| F025141 | Metagenome / Metatranscriptome | 203 | Y |
| F037503 | Metagenome / Metatranscriptome | 168 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| BIB32012_10037837 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| BIB32012_10062974 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| BIB32012_10117513 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 886 | Open in IMG/M |
| BIB32012_10135970 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 801 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| BIB32012_10037837 | BIB32012_100378372 | F000532 | VTLIKKRLNIEAVTAPGQKGQFEVVVDGESLVERGGNWFTRSFGAGYPDLESVVEQLEKRHAT* |
| BIB32012_10062974 | BIB32012_100629742 | F037503 | MEVELLIGLGGFTAYQPLTNSECHDTTSAVRLWVLRSIAERETTQTIS* |
| BIB32012_10117513 | BIB32012_101175131 | F025141 | MIQCEYCTRGFVDTANGLVAKTFHELLHEPDVVNK* |
| BIB32012_10135970 | BIB32012_101359702 | F025141 | MIECEYCPREFIETANGLAEKTFHELLHEPEVVNK* |
| ⦗Top⦘ |