3300001133: Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3

Overview

Basic Information

• IMG/M Taxon OID: 3300001133
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053054 | Gp0054773 | Ga0001351
• Sample Name: Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 12770070
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis	1
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From Rifle, Colorado, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → land → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Rifle, Colorado, USA
• Coordinates
  • Lat. (^o): 39.53
  • Long. (^o): -107.78
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025141	Metagenome / Metatranscriptome	203	Y
F067325	Metagenome	125	N
F100776	Metagenome	102	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
C687J13250_100354	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	1871
C687J13250_103082	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis	578
C687J13250_103415	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5	552

Sequences

Scaffold ID	Protein ID	Family	Sequence
C687J13250_100354	C687J13250_1003542	F025141	MIVCEYCPEKFVENMNGLVEKTFHELLHEPEMVNK*
C687J13250_103082	C687J13250_1030821	F100776	GLQEITGDLVSLTKQTIEHGIPQTFADPSVLNFEGYRQLEATPGSIYPATPKSGKSMQDAFYEIKTATLSAEVLPFFQQIQTLAQLVSGALPSLFGGQMDGSKTASEYSMSRAQALQRLQTTWKTFTIWWKQIFGKVIPAYIKDIVEDERLVEQDEQGNFVNTFIRMAELQGKIGSIELEANENLPMTWTQQ
C687J13250_103415	C687J13250_1034152	F067325	MEGRASPEGSREEVEFFLFIGSDYGTADVHSLRKESFALIDYFAGFLGPPASGPQPINIGELMDSEDEIPVNAFWRIREDHRAEIVAGLLKALEDQEKRDG*