| Basic Information | |
|---|---|
| Family ID | F006424 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 373 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MIGSGWVNSVFIRNDFPEFGSDLVTALSSLNVNDFSH |
| Number of Associated Samples | 310 |
| Number of Associated Scaffolds | 373 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 77.16 % |
| % of genes near scaffold ends (potentially truncated) | 92.23 % |
| % of genes from short scaffolds (< 2000 bps) | 95.17 % |
| Associated GOLD sequencing projects | 306 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (76.944 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (15.550 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.627 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (55.764 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 373 Family Scaffolds |
|---|---|---|
| PF00091 | Tubulin | 27.35 |
| PF03953 | Tubulin_C | 18.23 |
| PF00071 | Ras | 0.27 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.33 % |
| Unclassified | root | N/A | 13.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559017|JCVI_READ_768420 | All Organisms → cellular organisms → Eukaryota | 987 | Open in IMG/M |
| 3300002341|JGI24213J29975_1000924 | Not Available | 1337 | Open in IMG/M |
| 3300002343|JGI24214J29971_1003270 | All Organisms → cellular organisms → Eukaryota | 595 | Open in IMG/M |
| 3300002343|JGI24214J29971_1018616 | All Organisms → cellular organisms → Eukaryota | 1265 | Open in IMG/M |
| 3300002345|JGI24215J29973_1000322 | All Organisms → cellular organisms → Eukaryota | 1360 | Open in IMG/M |
| 3300003292|Ga0006242J48907_104366 | All Organisms → cellular organisms → Eukaryota | 1122 | Open in IMG/M |
| 3300003299|Ga0006244J48909_1002992 | All Organisms → cellular organisms → Eukaryota | 759 | Open in IMG/M |
| 3300003307|Ga0006883J46559_1022880 | All Organisms → cellular organisms → Eukaryota | 1340 | Open in IMG/M |
| 3300003555|Ga0008453J51685_107365 | All Organisms → cellular organisms → Eukaryota | 618 | Open in IMG/M |
| 3300003566|Ga0008455J51687_1000576 | All Organisms → cellular organisms → Eukaryota | 1242 | Open in IMG/M |
| 3300003574|Ga0007410J51695_1073934 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
| 3300003677|Ga0008458J53046_100129 | All Organisms → cellular organisms → Eukaryota | 781 | Open in IMG/M |
| 3300003683|Ga0008459J53047_1000037 | All Organisms → cellular organisms → Eukaryota | 1403 | Open in IMG/M |
| 3300003721|Ga0008275_101672 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1383 | Open in IMG/M |
| 3300003910|JGI26437J51864_10068693 | All Organisms → cellular organisms → Eukaryota | 767 | Open in IMG/M |
| 3300004786|Ga0007753_1440577 | All Organisms → cellular organisms → Eukaryota | 659 | Open in IMG/M |
| 3300004788|Ga0007742_10052336 | Not Available | 1011 | Open in IMG/M |
| 3300004792|Ga0007761_10045883 | All Organisms → cellular organisms → Eukaryota | 1338 | Open in IMG/M |
| 3300004796|Ga0007763_10030546 | All Organisms → cellular organisms → Eukaryota | 594 | Open in IMG/M |
| 3300006229|Ga0082389_118221 | All Organisms → cellular organisms → Eukaryota | 926 | Open in IMG/M |
| 3300006357|Ga0075502_1028138 | All Organisms → cellular organisms → Eukaryota | 1284 | Open in IMG/M |
| 3300006375|Ga0075490_1084248 | Not Available | 999 | Open in IMG/M |
| 3300006383|Ga0075504_1029499 | All Organisms → cellular organisms → Eukaryota | 520 | Open in IMG/M |
| 3300006390|Ga0075509_1004436 | All Organisms → cellular organisms → Eukaryota | 532 | Open in IMG/M |
| 3300006392|Ga0075507_1002519 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300006394|Ga0075492_1017718 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 786 | Open in IMG/M |
| 3300006397|Ga0075488_1073754 | All Organisms → cellular organisms → Eukaryota | 1210 | Open in IMG/M |
| 3300006399|Ga0075495_1028077 | All Organisms → cellular organisms → Eukaryota | 856 | Open in IMG/M |
| 3300007094|Ga0102532_1112050 | Not Available | 3265 | Open in IMG/M |
| 3300007162|Ga0079300_10131805 | All Organisms → cellular organisms → Eukaryota | 691 | Open in IMG/M |
| 3300008108|Ga0114341_10273050 | All Organisms → cellular organisms → Eukaryota | 896 | Open in IMG/M |
| 3300008109|Ga0114342_1001376 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 21368 | Open in IMG/M |
| 3300008119|Ga0114354_1112846 | All Organisms → cellular organisms → Eukaryota | 1061 | Open in IMG/M |
| 3300008796|Ga0103763_1026268 | All Organisms → cellular organisms → Eukaryota | 548 | Open in IMG/M |
| 3300008801|Ga0103768_1008886 | All Organisms → cellular organisms → Eukaryota | 688 | Open in IMG/M |
| 3300008832|Ga0103951_10328906 | All Organisms → cellular organisms → Eukaryota | 796 | Open in IMG/M |
| 3300008835|Ga0103883_1000072 | All Organisms → cellular organisms → Eukaryota | 1976 | Open in IMG/M |
| 3300008884|Ga0103746_10058333 | All Organisms → cellular organisms → Eukaryota | 505 | Open in IMG/M |
| 3300008958|Ga0104259_1021257 | All Organisms → cellular organisms → Eukaryota | 649 | Open in IMG/M |
| 3300009218|Ga0103848_1015329 | All Organisms → cellular organisms → Eukaryota | 1396 | Open in IMG/M |
| 3300009235|Ga0103857_10025186 | All Organisms → cellular organisms → Eukaryota | 1050 | Open in IMG/M |
| 3300009243|Ga0103860_10010304 | All Organisms → cellular organisms → Eukaryota | 1552 | Open in IMG/M |
| 3300009243|Ga0103860_10077995 | All Organisms → cellular organisms → Eukaryota | 693 | Open in IMG/M |
| 3300009263|Ga0103872_1000019 | All Organisms → Viruses → Predicted Viral | 2317 | Open in IMG/M |
| 3300009279|Ga0103880_10000524 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1638 | Open in IMG/M |
| 3300009334|Ga0103841_1000352 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1387 | Open in IMG/M |
| 3300009352|Ga0103865_1001400 | All Organisms → cellular organisms → Eukaryota | 1147 | Open in IMG/M |
| 3300009353|Ga0103847_1000469 | All Organisms → Viruses → Predicted Viral | 1394 | Open in IMG/M |
| 3300009357|Ga0103827_1000549 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1401 | Open in IMG/M |
| 3300009384|Ga0103868_1008904 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Chlorellales → Chlorellaceae → Helicosporidium → unclassified Helicosporidium → Helicosporidium sp. ATCC 50920 | 725 | Open in IMG/M |
| 3300009441|Ga0115007_10368193 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 937 | Open in IMG/M |
| 3300009550|Ga0115013_10113742 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1553 | Open in IMG/M |
| 3300009599|Ga0115103_1177596 | All Organisms → cellular organisms → Eukaryota | 844 | Open in IMG/M |
| 3300009599|Ga0115103_1338957 | All Organisms → cellular organisms → Eukaryota | 652 | Open in IMG/M |
| 3300009599|Ga0115103_1360613 | All Organisms → cellular organisms → Eukaryota → Sar | 529 | Open in IMG/M |
| 3300009599|Ga0115103_1473047 | All Organisms → cellular organisms → Eukaryota | 628 | Open in IMG/M |
| 3300009606|Ga0115102_10228520 | Not Available | 541 | Open in IMG/M |
| 3300009608|Ga0115100_10695074 | All Organisms → Viruses → Predicted Viral | 1417 | Open in IMG/M |
| 3300009679|Ga0115105_10580970 | All Organisms → Viruses → Predicted Viral | 1245 | Open in IMG/M |
| 3300009679|Ga0115105_11012001 | All Organisms → cellular organisms → Eukaryota | 568 | Open in IMG/M |
| 3300009679|Ga0115105_11354905 | All Organisms → cellular organisms → Eukaryota | 653 | Open in IMG/M |
| 3300009739|Ga0123362_1115884 | All Organisms → Viruses → Predicted Viral | 1352 | Open in IMG/M |
| 3300009756|Ga0123366_1081279 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
| 3300009869|Ga0130078_10446277 | All Organisms → cellular organisms → Eukaryota | 597 | Open in IMG/M |
| 3300010135|Ga0123382_1186025 | All Organisms → cellular organisms → Eukaryota | 566 | Open in IMG/M |
| 3300010306|Ga0129322_1070696 | All Organisms → cellular organisms → Eukaryota | 1340 | Open in IMG/M |
| 3300010306|Ga0129322_1079391 | All Organisms → cellular organisms → Eukaryota | 520 | Open in IMG/M |
| 3300010306|Ga0129322_1090445 | All Organisms → cellular organisms → Eukaryota | 1149 | Open in IMG/M |
| 3300010307|Ga0129319_1101562 | All Organisms → cellular organisms → Eukaryota | 709 | Open in IMG/M |
| 3300010974|Ga0138314_1068111 | All Organisms → cellular organisms → Eukaryota | 507 | Open in IMG/M |
| 3300010980|Ga0138321_10244456 | All Organisms → cellular organisms → Eukaryota | 723 | Open in IMG/M |
| 3300010987|Ga0138324_10036548 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1733 | Open in IMG/M |
| 3300010987|Ga0138324_10077221 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
| 3300010987|Ga0138324_10285138 | All Organisms → cellular organisms → Eukaryota | 787 | Open in IMG/M |
| 3300010987|Ga0138324_10513569 | All Organisms → cellular organisms → Eukaryota | 595 | Open in IMG/M |
| 3300011012|Ga0150979_1116805 | All Organisms → cellular organisms → Eukaryota | 1319 | Open in IMG/M |
| 3300011090|Ga0138579_1338303 | All Organisms → Viruses → Predicted Viral | 1308 | Open in IMG/M |
| 3300012370|Ga0123369_1089629 | All Organisms → Viruses → Predicted Viral | 1463 | Open in IMG/M |
| 3300012414|Ga0138264_1317272 | Not Available | 1431 | Open in IMG/M |
| 3300012414|Ga0138264_1729064 | All Organisms → cellular organisms → Eukaryota | 1019 | Open in IMG/M |
| 3300012415|Ga0138263_1510309 | All Organisms → cellular organisms → Eukaryota | 761 | Open in IMG/M |
| 3300012416|Ga0138259_1689211 | All Organisms → cellular organisms → Eukaryota | 1155 | Open in IMG/M |
| 3300012418|Ga0138261_1181541 | All Organisms → cellular organisms → Eukaryota | 821 | Open in IMG/M |
| 3300012472|Ga0129328_1049875 | All Organisms → cellular organisms → Eukaryota | 875 | Open in IMG/M |
| 3300012516|Ga0129325_1137486 | All Organisms → cellular organisms → Eukaryota | 1273 | Open in IMG/M |
| 3300012522|Ga0129326_1091194 | All Organisms → cellular organisms → Eukaryota | 1369 | Open in IMG/M |
| 3300012524|Ga0129331_1298207 | All Organisms → cellular organisms → Eukaryota | 544 | Open in IMG/M |
| 3300012700|Ga0157576_1123244 | All Organisms → cellular organisms → Eukaryota | 863 | Open in IMG/M |
| 3300012703|Ga0157572_1020744 | All Organisms → cellular organisms → Eukaryota | 690 | Open in IMG/M |
| 3300012706|Ga0157627_1085091 | All Organisms → cellular organisms → Eukaryota | 653 | Open in IMG/M |
| 3300012707|Ga0157623_1127775 | Not Available | 828 | Open in IMG/M |
| 3300012708|Ga0157595_1226126 | All Organisms → cellular organisms → Eukaryota | 950 | Open in IMG/M |
| 3300012711|Ga0157607_1025650 | Not Available | 1189 | Open in IMG/M |
| 3300012714|Ga0157601_1101643 | All Organisms → cellular organisms → Eukaryota | 871 | Open in IMG/M |
| 3300012714|Ga0157601_1143248 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Funariidae → Funariales → Funariaceae → Physcomitrium → Physcomitrium patens | 867 | Open in IMG/M |
| 3300012714|Ga0157601_1192666 | All Organisms → cellular organisms → Eukaryota | 1364 | Open in IMG/M |
| 3300012716|Ga0157605_1144839 | All Organisms → cellular organisms → Eukaryota | 1351 | Open in IMG/M |
| 3300012717|Ga0157609_1129648 | All Organisms → cellular organisms → Eukaryota | 787 | Open in IMG/M |
| 3300012724|Ga0157611_1083026 | All Organisms → cellular organisms → Eukaryota | 894 | Open in IMG/M |
| 3300012728|Ga0157552_1228931 | All Organisms → cellular organisms → Eukaryota | 585 | Open in IMG/M |
| 3300012729|Ga0157625_1065505 | Not Available | 796 | Open in IMG/M |
| 3300012731|Ga0157616_1128187 | All Organisms → cellular organisms → Eukaryota | 801 | Open in IMG/M |
| 3300012731|Ga0157616_1283186 | All Organisms → cellular organisms → Eukaryota | 1316 | Open in IMG/M |
| 3300012738|Ga0157537_110516 | Not Available | 526 | Open in IMG/M |
| 3300012751|Ga0138277_1084093 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi | 1261 | Open in IMG/M |
| 3300012751|Ga0138277_1119166 | All Organisms → cellular organisms → Eukaryota | 542 | Open in IMG/M |
| 3300012752|Ga0157629_1060825 | All Organisms → cellular organisms → Eukaryota | 1384 | Open in IMG/M |
| 3300012754|Ga0138278_1085557 | All Organisms → cellular organisms → Eukaryota | 582 | Open in IMG/M |
| 3300012754|Ga0138278_1160997 | All Organisms → cellular organisms → Eukaryota | 1371 | Open in IMG/M |
| 3300012756|Ga0138272_1181659 | All Organisms → cellular organisms → Eukaryota | 1273 | Open in IMG/M |
| 3300012758|Ga0138285_1102396 | All Organisms → cellular organisms → Eukaryota | 1217 | Open in IMG/M |
| 3300012759|Ga0157626_1085342 | All Organisms → cellular organisms → Eukaryota | 1208 | Open in IMG/M |
| 3300012760|Ga0138273_1070249 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1033 | Open in IMG/M |
| 3300012768|Ga0138276_1057001 | All Organisms → cellular organisms → Eukaryota | 723 | Open in IMG/M |
| 3300012768|Ga0138276_1090085 | All Organisms → cellular organisms → Eukaryota | 856 | Open in IMG/M |
| 3300012769|Ga0138279_1013554 | All Organisms → cellular organisms → Eukaryota | 1339 | Open in IMG/M |
| 3300012772|Ga0138287_1142170 | All Organisms → cellular organisms → Eukaryota | 888 | Open in IMG/M |
| 3300012935|Ga0138257_1679804 | All Organisms → cellular organisms → Eukaryota | 546 | Open in IMG/M |
| 3300012959|Ga0157620_1141849 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
| 3300012966|Ga0129341_1261641 | All Organisms → Viruses → Predicted Viral | 1244 | Open in IMG/M |
| 3300012969|Ga0129332_1185938 | All Organisms → cellular organisms → Eukaryota | 1356 | Open in IMG/M |
| 3300013005|Ga0164292_10693836 | All Organisms → cellular organisms → Eukaryota | 650 | Open in IMG/M |
| 3300013295|Ga0170791_10888008 | All Organisms → cellular organisms → Eukaryota | 1116 | Open in IMG/M |
| 3300013295|Ga0170791_11351817 | All Organisms → cellular organisms → Eukaryota | 811 | Open in IMG/M |
| 3300013295|Ga0170791_12171243 | All Organisms → cellular organisms → Eukaryota | 678 | Open in IMG/M |
| 3300013295|Ga0170791_12467276 | All Organisms → cellular organisms → Eukaryota | 665 | Open in IMG/M |
| 3300013310|Ga0157622_1029403 | All Organisms → cellular organisms → Eukaryota | 653 | Open in IMG/M |
| 3300013313|Ga0173629_10010163 | All Organisms → cellular organisms → Eukaryota | 1315 | Open in IMG/M |
| 3300016681|Ga0180043_105315 | All Organisms → cellular organisms → Eukaryota | 539 | Open in IMG/M |
| 3300016688|Ga0180039_1117984 | All Organisms → cellular organisms → Eukaryota | 533 | Open in IMG/M |
| 3300016699|Ga0180058_1207117 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 598 | Open in IMG/M |
| 3300016726|Ga0182045_1009996 | All Organisms → cellular organisms → Eukaryota | 700 | Open in IMG/M |
| 3300016726|Ga0182045_1295271 | All Organisms → cellular organisms → Eukaryota | 598 | Open in IMG/M |
| 3300016727|Ga0182051_1022698 | All Organisms → cellular organisms → Eukaryota | 1261 | Open in IMG/M |
| 3300016727|Ga0182051_1285693 | All Organisms → cellular organisms → Eukaryota | 544 | Open in IMG/M |
| 3300016727|Ga0182051_1308114 | All Organisms → cellular organisms → Eukaryota | 526 | Open in IMG/M |
| 3300016742|Ga0182052_1050144 | All Organisms → cellular organisms → Eukaryota | 1089 | Open in IMG/M |
| 3300016748|Ga0182043_1027428 | All Organisms → cellular organisms → Eukaryota | 669 | Open in IMG/M |
| 3300016748|Ga0182043_1194618 | All Organisms → cellular organisms → Eukaryota | 1324 | Open in IMG/M |
| 3300016748|Ga0182043_1336519 | All Organisms → cellular organisms → Eukaryota | 1005 | Open in IMG/M |
| 3300016749|Ga0182053_1140715 | All Organisms → cellular organisms → Eukaryota | 640 | Open in IMG/M |
| 3300016754|Ga0182072_1041975 | All Organisms → cellular organisms → Eukaryota | 629 | Open in IMG/M |
| 3300016762|Ga0182084_1466329 | All Organisms → cellular organisms → Eukaryota | 511 | Open in IMG/M |
| 3300016766|Ga0182091_1323153 | All Organisms → cellular organisms → Eukaryota | 1016 | Open in IMG/M |
| 3300016781|Ga0182063_1340158 | All Organisms → cellular organisms → Eukaryota | 588 | Open in IMG/M |
| 3300018537|Ga0193019_100723 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1351 | Open in IMG/M |
| 3300018565|Ga0188826_102438 | All Organisms → cellular organisms → Eukaryota | 1402 | Open in IMG/M |
| 3300018574|Ga0188842_1000582 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
| 3300018593|Ga0192844_1001586 | All Organisms → Viruses → Predicted Viral | 1432 | Open in IMG/M |
| 3300018599|Ga0188834_1003574 | All Organisms → cellular organisms → Eukaryota | 1412 | Open in IMG/M |
| 3300018599|Ga0188834_1004073 | All Organisms → cellular organisms → Eukaryota | 1357 | Open in IMG/M |
| 3300018599|Ga0188834_1010075 | All Organisms → cellular organisms → Eukaryota | 965 | Open in IMG/M |
| 3300018601|Ga0188850_1001144 | All Organisms → cellular organisms → Eukaryota | 1543 | Open in IMG/M |
| 3300018601|Ga0188850_1001146 | All Organisms → cellular organisms → Eukaryota | 1543 | Open in IMG/M |
| 3300018601|Ga0188850_1002072 | All Organisms → cellular organisms → Eukaryota | 1351 | Open in IMG/M |
| 3300018607|Ga0188821_1002198 | All Organisms → cellular organisms → Eukaryota | 1395 | Open in IMG/M |
| 3300018610|Ga0188884_1002208 | All Organisms → cellular organisms → Eukaryota | 1339 | Open in IMG/M |
| 3300018614|Ga0188846_1005162 | All Organisms → cellular organisms → Eukaryota | 1382 | Open in IMG/M |
| 3300018614|Ga0188846_1005726 | All Organisms → cellular organisms → Eukaryota | 1344 | Open in IMG/M |
| 3300018621|Ga0193093_1009600 | All Organisms → cellular organisms → Eukaryota | 1427 | Open in IMG/M |
| 3300018629|Ga0188875_1004750 | All Organisms → cellular organisms → Eukaryota | 999 | Open in IMG/M |
| 3300018640|Ga0188880_1003793 | All Organisms → cellular organisms → Eukaryota | 1338 | Open in IMG/M |
| 3300018696|Ga0193110_1018324 | All Organisms → cellular organisms → Eukaryota | 746 | Open in IMG/M |
| 3300018702|Ga0193439_1003176 | All Organisms → cellular organisms → Eukaryota | 1511 | Open in IMG/M |
| 3300018710|Ga0192984_1019975 | Not Available | 1378 | Open in IMG/M |
| 3300018716|Ga0193324_1034674 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 637 | Open in IMG/M |
| 3300018724|Ga0193391_1006069 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
| 3300018725|Ga0193517_1017297 | All Organisms → Viruses → Predicted Viral | 1411 | Open in IMG/M |
| 3300018732|Ga0193381_1007341 | All Organisms → Viruses → Predicted Viral | 1345 | Open in IMG/M |
| 3300018736|Ga0192879_1027965 | All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Kinetoplastea → Metakinetoplastina → Trypanosomatida → Trypanosomatidae → Leishmaniinae → Leishmania → Leishmania → Leishmania donovani species complex → Leishmania infantum | 1354 | Open in IMG/M |
| 3300018742|Ga0193138_1016458 | All Organisms → cellular organisms → Eukaryota | 941 | Open in IMG/M |
| 3300018742|Ga0193138_1024438 | All Organisms → cellular organisms → Eukaryota | 788 | Open in IMG/M |
| 3300018745|Ga0193000_1006965 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1442 | Open in IMG/M |
| 3300018746|Ga0193468_1009812 | All Organisms → cellular organisms → Eukaryota | 1355 | Open in IMG/M |
| 3300018754|Ga0193346_1043707 | All Organisms → cellular organisms → Eukaryota | 612 | Open in IMG/M |
| 3300018761|Ga0193063_1014790 | All Organisms → cellular organisms → Eukaryota | 1245 | Open in IMG/M |
| 3300018761|Ga0193063_1027426 | All Organisms → cellular organisms → Eukaryota | 942 | Open in IMG/M |
| 3300018766|Ga0193181_1005586 | All Organisms → Viruses → Predicted Viral | 1423 | Open in IMG/M |
| 3300018766|Ga0193181_1005934 | All Organisms → Viruses → Predicted Viral | 1400 | Open in IMG/M |
| 3300018766|Ga0193181_1006225 | All Organisms → cellular organisms → Eukaryota | 1380 | Open in IMG/M |
| 3300018766|Ga0193181_1026349 | All Organisms → cellular organisms → Eukaryota | 827 | Open in IMG/M |
| 3300018768|Ga0193503_1008594 | All Organisms → Viruses → Predicted Viral | 1393 | Open in IMG/M |
| 3300018771|Ga0193314_1054785 | All Organisms → cellular organisms → Eukaryota | 687 | Open in IMG/M |
| 3300018801|Ga0192824_1021831 | All Organisms → Viruses → Predicted Viral | 1370 | Open in IMG/M |
| 3300018810|Ga0193422_1014319 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
| 3300018817|Ga0193187_1014248 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1415 | Open in IMG/M |
| 3300018824|Ga0188874_1025630 | All Organisms → cellular organisms → Eukaryota | 633 | Open in IMG/M |
| 3300018824|Ga0188874_1025639 | All Organisms → cellular organisms → Eukaryota | 633 | Open in IMG/M |
| 3300018825|Ga0193048_1034716 | Not Available | 761 | Open in IMG/M |
| 3300018842|Ga0193219_1010513 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 1292 | Open in IMG/M |
| 3300018899|Ga0193090_1071540 | All Organisms → cellular organisms → Eukaryota | 804 | Open in IMG/M |
| 3300018928|Ga0193260_10018980 | All Organisms → Viruses → Predicted Viral | 1368 | Open in IMG/M |
| 3300018980|Ga0192961_10168006 | All Organisms → cellular organisms → Eukaryota | 666 | Open in IMG/M |
| 3300018998|Ga0193444_10048772 | All Organisms → cellular organisms → Eukaryota | 1058 | Open in IMG/M |
| 3300019001|Ga0193034_10005135 | All Organisms → cellular organisms → Eukaryota | 1504 | Open in IMG/M |
| 3300019006|Ga0193154_10059588 | All Organisms → Viruses → Predicted Viral | 1307 | Open in IMG/M |
| 3300019019|Ga0193555_10053779 | All Organisms → cellular organisms → Eukaryota | 1462 | Open in IMG/M |
| 3300019085|Ga0188830_1001898 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300019116|Ga0193243_1003680 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1470 | Open in IMG/M |
| 3300019118|Ga0193157_1009326 | All Organisms → cellular organisms → Eukaryota | 911 | Open in IMG/M |
| 3300019138|Ga0193216_10155726 | All Organisms → cellular organisms → Eukaryota | 512 | Open in IMG/M |
| 3300019145|Ga0193288_1006945 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
| 3300019146|Ga0188881_10034979 | All Organisms → cellular organisms → Eukaryota | 624 | Open in IMG/M |
| 3300019149|Ga0188870_10098822 | All Organisms → cellular organisms → Eukaryota | 701 | Open in IMG/M |
| 3300019207|Ga0180034_1101227 | All Organisms → cellular organisms → Eukaryota | 804 | Open in IMG/M |
| 3300019261|Ga0182097_1342163 | All Organisms → cellular organisms → Eukaryota | 726 | Open in IMG/M |
| 3300019267|Ga0182069_1454661 | All Organisms → cellular organisms → Eukaryota | 550 | Open in IMG/M |
| 3300019272|Ga0182059_1177962 | All Organisms → cellular organisms → Eukaryota | 527 | Open in IMG/M |
| 3300019283|Ga0182058_1534976 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi | 1135 | Open in IMG/M |
| 3300020013|Ga0182086_1026232 | All Organisms → cellular organisms → Eukaryota | 1380 | Open in IMG/M |
| 3300020013|Ga0182086_1102307 | All Organisms → cellular organisms → Eukaryota | 511 | Open in IMG/M |
| 3300020014|Ga0182044_1003563 | All Organisms → cellular organisms → Eukaryota | 643 | Open in IMG/M |
| 3300020014|Ga0182044_1007881 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300020014|Ga0182044_1013818 | All Organisms → cellular organisms → Eukaryota | 999 | Open in IMG/M |
| 3300020014|Ga0182044_1149518 | All Organisms → cellular organisms → Eukaryota | 1320 | Open in IMG/M |
| 3300020070|Ga0206356_10129523 | All Organisms → cellular organisms → Eukaryota | 1477 | Open in IMG/M |
| 3300020190|Ga0194118_10103869 | All Organisms → cellular organisms → Eukaryota | 1739 | Open in IMG/M |
| 3300020204|Ga0194116_10119212 | All Organisms → cellular organisms → Eukaryota | 1646 | Open in IMG/M |
| 3300020205|Ga0211731_10676285 | All Organisms → cellular organisms → Eukaryota | 5817 | Open in IMG/M |
| 3300021169|Ga0206687_1031312 | All Organisms → cellular organisms → Eukaryota | 560 | Open in IMG/M |
| 3300021169|Ga0206687_1355562 | Not Available | 862 | Open in IMG/M |
| 3300021169|Ga0206687_1626351 | All Organisms → cellular organisms → Eukaryota | 678 | Open in IMG/M |
| 3300021284|Ga0210299_130891 | All Organisms → cellular organisms → Eukaryota | 1089 | Open in IMG/M |
| 3300021284|Ga0210299_177049 | All Organisms → cellular organisms → Eukaryota | 1359 | Open in IMG/M |
| 3300021298|Ga0210349_1161023 | All Organisms → cellular organisms → Eukaryota | 1136 | Open in IMG/M |
| 3300021303|Ga0210308_1050764 | All Organisms → cellular organisms → Eukaryota | 940 | Open in IMG/M |
| 3300021308|Ga0210350_1030152 | All Organisms → cellular organisms → Eukaryota | 1053 | Open in IMG/M |
| 3300021317|Ga0210309_1173960 | All Organisms → cellular organisms → Eukaryota | 621 | Open in IMG/M |
| 3300021342|Ga0206691_1089029 | All Organisms → cellular organisms → Eukaryota | 1001 | Open in IMG/M |
| 3300021342|Ga0206691_1743060 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Scuticociliatia → Philasterida → Philasteridae → Miamiensis → Miamiensis avidus | 585 | Open in IMG/M |
| 3300021348|Ga0206695_1389402 | All Organisms → cellular organisms → Eukaryota | 508 | Open in IMG/M |
| 3300021350|Ga0206692_1015818 | Not Available | 817 | Open in IMG/M |
| 3300021353|Ga0206693_1562938 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1425 | Open in IMG/M |
| 3300021856|Ga0213850_1119326 | All Organisms → cellular organisms → Eukaryota | 830 | Open in IMG/M |
| 3300021872|Ga0063132_115684 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1175 | Open in IMG/M |
| 3300021874|Ga0063147_101170 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1369 | Open in IMG/M |
| 3300021877|Ga0063123_1000995 | All Organisms → Viruses → Predicted Viral | 1350 | Open in IMG/M |
| 3300021881|Ga0063117_1006878 | All Organisms → cellular organisms → Eukaryota | 917 | Open in IMG/M |
| 3300021885|Ga0063125_1016192 | Not Available | 1135 | Open in IMG/M |
| 3300021886|Ga0063114_1026590 | All Organisms → cellular organisms → Eukaryota | 668 | Open in IMG/M |
| 3300021895|Ga0063120_1011995 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 862 | Open in IMG/M |
| 3300021897|Ga0063873_1000931 | All Organisms → cellular organisms → Eukaryota | 871 | Open in IMG/M |
| 3300021899|Ga0063144_1013394 | All Organisms → cellular organisms → Eukaryota | 690 | Open in IMG/M |
| 3300021899|Ga0063144_1013534 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
| 3300021904|Ga0063131_1006013 | All Organisms → Viruses → Predicted Viral | 1361 | Open in IMG/M |
| 3300021910|Ga0063100_1000688 | Not Available | 1386 | Open in IMG/M |
| 3300021928|Ga0063134_1072736 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Aculeata → Formicoidea → Formicidae → Myrmicinae → Attini | 719 | Open in IMG/M |
| 3300021929|Ga0213845_1096880 | All Organisms → cellular organisms → Eukaryota | 500 | Open in IMG/M |
| 3300021930|Ga0063145_1002144 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1359 | Open in IMG/M |
| 3300022533|Ga0242662_10322578 | All Organisms → cellular organisms → Eukaryota | 520 | Open in IMG/M |
| 3300022829|Ga0222706_1017711 | All Organisms → cellular organisms → Eukaryota | 703 | Open in IMG/M |
| 3300023685|Ga0228686_1016003 | All Organisms → cellular organisms → Eukaryota | 998 | Open in IMG/M |
| 3300023694|Ga0228683_1031762 | Not Available | 579 | Open in IMG/M |
| 3300023698|Ga0228682_1058798 | All Organisms → cellular organisms → Eukaryota | 520 | Open in IMG/M |
| 3300023700|Ga0228707_1008303 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines | 1464 | Open in IMG/M |
| 3300023702|Ga0232119_1075336 | All Organisms → cellular organisms → Eukaryota | 502 | Open in IMG/M |
| 3300023706|Ga0232123_1045387 | Not Available | 892 | Open in IMG/M |
| 3300023708|Ga0228709_1133267 | All Organisms → cellular organisms → Eukaryota | 506 | Open in IMG/M |
| 3300023709|Ga0232122_1041198 | All Organisms → cellular organisms → Eukaryota | 1176 | Open in IMG/M |
| 3300024483|Ga0255224_1016802 | All Organisms → cellular organisms → Eukaryota | 1407 | Open in IMG/M |
| 3300024483|Ga0255224_1071104 | Not Available | 723 | Open in IMG/M |
| 3300024531|Ga0255228_1044551 | All Organisms → cellular organisms → Eukaryota | 888 | Open in IMG/M |
| 3300024532|Ga0256352_1011308 | All Organisms → cellular organisms → Eukaryota | 1555 | Open in IMG/M |
| 3300024532|Ga0256352_1046589 | Not Available | 776 | Open in IMG/M |
| 3300024536|Ga0256338_1020229 | All Organisms → cellular organisms → Eukaryota | 1475 | Open in IMG/M |
| 3300024546|Ga0256356_1068987 | All Organisms → cellular organisms → Eukaryota | 649 | Open in IMG/M |
| 3300024547|Ga0255292_1041378 | All Organisms → cellular organisms → Eukaryota | 910 | Open in IMG/M |
| 3300024547|Ga0255292_1107659 | All Organisms → cellular organisms → Eukaryota | 547 | Open in IMG/M |
| 3300024571|Ga0256302_1148016 | All Organisms → cellular organisms → Eukaryota | 553 | Open in IMG/M |
| 3300024573|Ga0256337_1104930 | All Organisms → cellular organisms → Eukaryota | 706 | Open in IMG/M |
| 3300024848|Ga0255229_1012986 | All Organisms → cellular organisms → Eukaryota | 1340 | Open in IMG/M |
| 3300024862|Ga0256317_1077415 | All Organisms → cellular organisms → Eukaryota | 731 | Open in IMG/M |
| 3300024862|Ga0256317_1126150 | All Organisms → cellular organisms → Eukaryota | 559 | Open in IMG/M |
| 3300024863|Ga0255246_1154618 | All Organisms → cellular organisms → Eukaryota | 532 | Open in IMG/M |
| 3300024865|Ga0256340_1026811 | All Organisms → cellular organisms → Eukaryota | 1462 | Open in IMG/M |
| 3300025757|Ga0256313_1041443 | All Organisms → cellular organisms → Eukaryota | 681 | Open in IMG/M |
| 3300025809|Ga0209199_1141612 | All Organisms → cellular organisms → Eukaryota | 912 | Open in IMG/M |
| 3300026415|Ga0256298_1016222 | All Organisms → cellular organisms → Eukaryota | 980 | Open in IMG/M |
| 3300026448|Ga0247594_1072447 | All Organisms → cellular organisms → Eukaryota | 599 | Open in IMG/M |
| 3300026461|Ga0247600_1032021 | All Organisms → cellular organisms → Eukaryota | 1012 | Open in IMG/M |
| 3300026468|Ga0247603_1036541 | All Organisms → cellular organisms → Eukaryota | 970 | Open in IMG/M |
| 3300026495|Ga0247571_1058806 | All Organisms → cellular organisms → Eukaryota | 873 | Open in IMG/M |
| 3300026573|Ga0255269_1201076 | All Organisms → cellular organisms → Eukaryota | 530 | Open in IMG/M |
| 3300027906|Ga0209404_11213824 | All Organisms → cellular organisms → Eukaryota | 519 | Open in IMG/M |
| 3300028134|Ga0256411_1064033 | All Organisms → cellular organisms → Eukaryota | 1259 | Open in IMG/M |
| 3300028137|Ga0256412_1287331 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Piroplasmida → Babesiidae → Babesia | 606 | Open in IMG/M |
| 3300028233|Ga0256417_1146355 | Not Available | 635 | Open in IMG/M |
| 3300028233|Ga0256417_1222262 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 504 | Open in IMG/M |
| 3300028282|Ga0256413_1077649 | All Organisms → cellular organisms → Eukaryota | 1187 | Open in IMG/M |
| 3300028282|Ga0256413_1137706 | All Organisms → cellular organisms → Eukaryota | 886 | Open in IMG/M |
| 3300028329|Ga0210315_1010286 | Not Available | 1105 | Open in IMG/M |
| 3300028329|Ga0210315_1032241 | All Organisms → cellular organisms → Eukaryota | 672 | Open in IMG/M |
| 3300028334|Ga0247597_1053390 | All Organisms → cellular organisms → Eukaryota | 550 | Open in IMG/M |
| 3300028334|Ga0247597_1058688 | All Organisms → cellular organisms → Eukaryota | 527 | Open in IMG/M |
| 3300028337|Ga0247579_1046928 | All Organisms → cellular organisms → Eukaryota | 900 | Open in IMG/M |
| 3300028396|Ga0228643_1152029 | All Organisms → cellular organisms → Eukaryota | 521 | Open in IMG/M |
| 3300028554|Ga0302047_10606129 | All Organisms → cellular organisms → Eukaryota | 653 | Open in IMG/M |
| 3300028575|Ga0304731_10293974 | All Organisms → cellular organisms → Eukaryota | 531 | Open in IMG/M |
| 3300028647|Ga0272412_1109073 | All Organisms → cellular organisms → Eukaryota | 1176 | Open in IMG/M |
| 3300029952|Ga0311346_11032027 | All Organisms → cellular organisms → Eukaryota | 660 | Open in IMG/M |
| 3300029983|Ga0302284_1090788 | All Organisms → cellular organisms → Eukaryota | 977 | Open in IMG/M |
| 3300030339|Ga0311360_10276295 | All Organisms → cellular organisms → Eukaryota | 1361 | Open in IMG/M |
| 3300030551|Ga0247638_1164981 | Not Available | 546 | Open in IMG/M |
| 3300030609|Ga0247634_10019581 | All Organisms → Viruses → Predicted Viral | 1237 | Open in IMG/M |
| 3300030610|Ga0247613_10250110 | All Organisms → cellular organisms → Eukaryota | 648 | Open in IMG/M |
| 3300030611|Ga0257182_1019182 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
| 3300030699|Ga0307398_10184585 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
| 3300030702|Ga0307399_10238083 | All Organisms → cellular organisms → Eukaryota | 852 | Open in IMG/M |
| 3300030720|Ga0308139_1016417 | All Organisms → cellular organisms → Eukaryota | 1052 | Open in IMG/M |
| 3300030721|Ga0308133_1040489 | All Organisms → cellular organisms → Eukaryota | 630 | Open in IMG/M |
| 3300030722|Ga0308137_1078284 | All Organisms → cellular organisms → Eukaryota | 587 | Open in IMG/M |
| 3300030724|Ga0308138_1021821 | All Organisms → cellular organisms → Eukaryota | 920 | Open in IMG/M |
| 3300030786|Ga0073966_10027552 | All Organisms → cellular organisms → Eukaryota | 534 | Open in IMG/M |
| 3300030856|Ga0073990_12026313 | All Organisms → cellular organisms → Eukaryota | 745 | Open in IMG/M |
| 3300030857|Ga0073981_10005880 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 585 | Open in IMG/M |
| 3300030859|Ga0073963_11553986 | All Organisms → cellular organisms → Eukaryota | 600 | Open in IMG/M |
| 3300030865|Ga0073972_11382414 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Scuticociliatia → Philasterida → Philasteridae → Miamiensis → Miamiensis avidus | 536 | Open in IMG/M |
| 3300030869|Ga0151492_1013670 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1359 | Open in IMG/M |
| 3300030951|Ga0073937_12089123 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
| 3300030957|Ga0073976_10014769 | All Organisms → cellular organisms → Eukaryota | 883 | Open in IMG/M |
| 3300031005|Ga0073974_1015499 | All Organisms → cellular organisms → Eukaryota | 706 | Open in IMG/M |
| 3300031006|Ga0073973_1005334 | All Organisms → cellular organisms → Eukaryota | 1312 | Open in IMG/M |
| 3300031113|Ga0138347_10721795 | All Organisms → cellular organisms → Eukaryota | 717 | Open in IMG/M |
| 3300031335|Ga0307951_1069445 | Not Available | 1137 | Open in IMG/M |
| 3300031340|Ga0308146_1058375 | All Organisms → cellular organisms → Eukaryota | 649 | Open in IMG/M |
| 3300031382|Ga0307971_1117729 | All Organisms → cellular organisms → Eukaryota | 792 | Open in IMG/M |
| 3300031382|Ga0307971_1175617 | All Organisms → cellular organisms → Eukaryota | 604 | Open in IMG/M |
| 3300031445|Ga0073952_10029049 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 946 | Open in IMG/M |
| 3300031446|Ga0170820_16985027 | All Organisms → cellular organisms → Eukaryota | 1429 | Open in IMG/M |
| 3300031469|Ga0170819_11540053 | Not Available | 586 | Open in IMG/M |
| 3300031570|Ga0308144_1012063 | All Organisms → cellular organisms → Eukaryota | 1101 | Open in IMG/M |
| 3300031579|Ga0308134_1043823 | All Organisms → cellular organisms → Eukaryota | 1024 | Open in IMG/M |
| 3300031594|Ga0302131_1213720 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | 626 | Open in IMG/M |
| 3300031674|Ga0307393_1041322 | Not Available | 931 | Open in IMG/M |
| 3300031725|Ga0307381_10057601 | All Organisms → cellular organisms → Eukaryota | 1196 | Open in IMG/M |
| 3300031735|Ga0307394_10079464 | Not Available | 1213 | Open in IMG/M |
| 3300031737|Ga0307387_10130245 | All Organisms → cellular organisms → Eukaryota | 1352 | Open in IMG/M |
| 3300031737|Ga0307387_10613126 | All Organisms → cellular organisms → Eukaryota | 681 | Open in IMG/M |
| 3300031739|Ga0307383_10088270 | All Organisms → cellular organisms → Eukaryota | 1346 | Open in IMG/M |
| 3300032470|Ga0314670_10634465 | Not Available | 550 | Open in IMG/M |
| 3300032491|Ga0314675_10421797 | Not Available | 665 | Open in IMG/M |
| 3300032517|Ga0314688_10400777 | Not Available | 743 | Open in IMG/M |
| 3300032518|Ga0314689_10104851 | All Organisms → cellular organisms → Eukaryota | 1356 | Open in IMG/M |
| 3300032518|Ga0314689_10258069 | All Organisms → cellular organisms → Eukaryota | 910 | Open in IMG/M |
| 3300032521|Ga0314680_10966525 | Not Available | 533 | Open in IMG/M |
| 3300032615|Ga0314674_10516753 | All Organisms → cellular organisms → Eukaryota | 615 | Open in IMG/M |
| 3300032616|Ga0314671_10583570 | Not Available | 605 | Open in IMG/M |
| 3300032617|Ga0314683_10761087 | Not Available | 586 | Open in IMG/M |
| 3300032666|Ga0314678_10111397 | All Organisms → cellular organisms → Eukaryota | 1095 | Open in IMG/M |
| 3300032709|Ga0314672_1355134 | Not Available | 541 | Open in IMG/M |
| 3300032714|Ga0314686_10642198 | All Organisms → cellular organisms → Eukaryota | 512 | Open in IMG/M |
| 3300032726|Ga0314698_10180716 | Not Available | 949 | Open in IMG/M |
| 3300032730|Ga0314699_10441892 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 586 | Open in IMG/M |
| 3300032733|Ga0314714_10570314 | All Organisms → cellular organisms → Eukaryota | 628 | Open in IMG/M |
| 3300032733|Ga0314714_10644816 | Not Available | 583 | Open in IMG/M |
| 3300032746|Ga0314701_10259047 | All Organisms → cellular organisms → Eukaryota | 786 | Open in IMG/M |
| 3300032749|Ga0314691_10438190 | Not Available | 539 | Open in IMG/M |
| 3300032754|Ga0314692_10093626 | All Organisms → cellular organisms → Eukaryota | 1460 | Open in IMG/M |
| 3300032756|Ga0315742_10526210 | All Organisms → cellular organisms → Eukaryota | 1003 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 15.55% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 14.48% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.70% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.17% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 5.36% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.63% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.09% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.83% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.95% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 2.41% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 1.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.34% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.07% |
| Wastewater Treatment | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment | 1.07% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.80% |
| Surface Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water | 0.80% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.54% |
| Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine | 0.54% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.54% |
| Fungi-Associated Bovine Rumen | Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen | 0.54% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.54% |
| Eutrophic Pond | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Eutrophic Pond | 0.54% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.27% |
| Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.27% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.27% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.27% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.27% |
| Rumen | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen | 0.27% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.27% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.27% |
| Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 0.27% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559017 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573) | Environmental | Open in IMG/M |
| 3300002341 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - D_52min_Anaerobic (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002343 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - F_92min_Anaerobic (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002345 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - H_11min_Aerobic (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300003292 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C27A4_80 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003299 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C43A7_35 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003307 | Hypersaline microbial mat communities from Elkhorn Slough, Monterey Bay, California, USA - CR8A/B (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003555 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_17_M020 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003566 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_07_M0_10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003677 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003683 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003721 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003910 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW | Environmental | Open in IMG/M |
| 3300004786 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004788 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006229 | Marine sediment microbial communities, 0.9 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC143 | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006383 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006390 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006392 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006394 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006397 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006399 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007094 | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008109 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-53-LTR | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008796 | Planktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample KO-1 | Environmental | Open in IMG/M |
| 3300008801 | Planktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample NO3-3 | Environmental | Open in IMG/M |
| 3300008832 | Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150 | Environmental | Open in IMG/M |
| 3300008835 | Eukaryotic communities of water from the North Atlantic ocean - ACM44 | Environmental | Open in IMG/M |
| 3300008884 | Microbial communities of wastewater sludge from Singapore - Sludge3_b2_February | Environmental | Open in IMG/M |
| 3300008958 | Marine microbial communities from eastern North Pacific Ocean - P1 particle-associated | Environmental | Open in IMG/M |
| 3300009006 | Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2 | Environmental | Open in IMG/M |
| 3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
| 3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
| 3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
| 3300009263 | Eukaryotic communities of water from the North Atlantic ocean - ACM27 | Environmental | Open in IMG/M |
| 3300009279 | Eukaryotic communities of water from the North Atlantic ocean - ACM42 | Environmental | Open in IMG/M |
| 3300009334 | Microbial communities of water from the North Atlantic ocean - ACM46 | Environmental | Open in IMG/M |
| 3300009352 | Microbial communities of water from Amazon river, Brazil - RCM18 | Environmental | Open in IMG/M |
| 3300009353 | Microbial communities of water from the North Atlantic ocean - ACM49 | Environmental | Open in IMG/M |
| 3300009357 | Microbial communities of water from the North Atlantic ocean - ACM13 | Environmental | Open in IMG/M |
| 3300009384 | Microbial communities of water from Amazon river, Brazil - RCM21 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009739 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_194_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009756 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_202_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009869 | Cow rumen microbiome (microbial/fungal) from cows held on UI at Urbana campus farm, Champaign, IL - Corn Stover. Combined Assembly of Gp0148673, Gp0148674 | Host-Associated | Open in IMG/M |
| 3300010135 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_257_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010306 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010307 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010974 | Metatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-1 corn stover (Eukaryote Community Metatranscriptome) (version 2) | Host-Associated | Open in IMG/M |
| 3300010980 | Metatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-1 corn stover (Eukaryote Community Metatranscriptome) (version 8) | Host-Associated | Open in IMG/M |
| 3300010987 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6) | Environmental | Open in IMG/M |
| 3300011012 | Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012370 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_209_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012414 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012415 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012416 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012418 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012472 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012516 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012522 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012700 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES079 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012703 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA- GEODES074 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012728 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012738 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES023 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012751 | Freshwater microbial communities from Lake Montjoie, Canada - M_130821_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012752 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012754 | Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012756 | Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012758 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012760 | Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012769 | Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012935 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012959 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES150 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012966 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012969 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013313 | Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs re-assembly | Environmental | Open in IMG/M |
| 3300016681 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES152 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016688 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES053 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016699 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016726 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016727 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016742 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016748 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016749 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016754 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016762 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016766 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016781 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018537 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003035 (ERX1789644-ERR1719455) | Environmental | Open in IMG/M |
| 3300018565 | Metatranscriptome of marine microbial communities from Baltic Sea - GS669_3p0_dT | Environmental | Open in IMG/M |
| 3300018574 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_3p0_dT | Environmental | Open in IMG/M |
| 3300018580 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003039 (ERX1789370-ERR1719227) | Environmental | Open in IMG/M |
| 3300018593 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000600 (ERX1782171-ERR1712017) | Environmental | Open in IMG/M |
| 3300018599 | Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dT | Environmental | Open in IMG/M |
| 3300018601 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_3p0_dT | Environmental | Open in IMG/M |
| 3300018607 | Metatranscriptome of freshwater lake microbial communities from Lake Tornetrask, Sweden - GS667_3p0_dT | Environmental | Open in IMG/M |
| 3300018610 | Metatranscriptome of marine microbial communities from Baltic Sea - LD35M_ls2 | Environmental | Open in IMG/M |
| 3300018614 | Metatranscriptome of marine microbial communities from Baltic Sea - GS678_3p0_dT | Environmental | Open in IMG/M |
| 3300018621 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001561 (ERX1782270-ERR1712225) | Environmental | Open in IMG/M |
| 3300018629 | Metatranscriptome of marine microbial communities from Baltic Sea - GS852_ls4 | Environmental | Open in IMG/M |
| 3300018640 | Metatranscriptome of marine microbial communities from Baltic Sea - GS859_ls5 | Environmental | Open in IMG/M |
| 3300018696 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000864 (ERX1782143-ERR1711870) | Environmental | Open in IMG/M |
| 3300018702 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002354 (ERX1789558-ERR1719169) | Environmental | Open in IMG/M |
| 3300018710 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809766-ERR1740136) | Environmental | Open in IMG/M |
| 3300018716 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001728 (ERX1789726-ERR1719299) | Environmental | Open in IMG/M |
| 3300018724 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789589-ERR1719194) | Environmental | Open in IMG/M |
| 3300018725 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230) | Environmental | Open in IMG/M |
| 3300018732 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789574-ERR1719298) | Environmental | Open in IMG/M |
| 3300018736 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000750 (ERX1789504-ERR1719154) | Environmental | Open in IMG/M |
| 3300018742 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224) | Environmental | Open in IMG/M |
| 3300018745 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134) | Environmental | Open in IMG/M |
| 3300018746 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155) | Environmental | Open in IMG/M |
| 3300018754 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001810 (ERX1789618-ERR1719236) | Environmental | Open in IMG/M |
| 3300018761 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002934 (ERX1789455-ERR1719449) | Environmental | Open in IMG/M |
| 3300018766 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465) | Environmental | Open in IMG/M |
| 3300018768 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003011 (ERX1789448-ERR1719377) | Environmental | Open in IMG/M |
| 3300018771 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001658 (ERX1789535-ERR1719438) | Environmental | Open in IMG/M |
| 3300018801 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434) | Environmental | Open in IMG/M |
| 3300018810 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002291 (ERX1789538-ERR1719380) | Environmental | Open in IMG/M |
| 3300018817 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000030 (ERX1789390-ERR1719248) | Environmental | Open in IMG/M |
| 3300018824 | Metatranscriptome of marine microbial communities from Baltic Sea - GS850_ls4 | Environmental | Open in IMG/M |
| 3300018825 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127) | Environmental | Open in IMG/M |
| 3300018842 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218) | Environmental | Open in IMG/M |
| 3300018899 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133) | Environmental | Open in IMG/M |
| 3300018928 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386) | Environmental | Open in IMG/M |
| 3300018980 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127) | Environmental | Open in IMG/M |
| 3300018998 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117) | Environmental | Open in IMG/M |
| 3300019001 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007) | Environmental | Open in IMG/M |
| 3300019006 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936) | Environmental | Open in IMG/M |
| 3300019019 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929 | Environmental | Open in IMG/M |
| 3300019032 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216) | Environmental | Open in IMG/M |
| 3300019085 | Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dT | Environmental | Open in IMG/M |
| 3300019116 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967) | Environmental | Open in IMG/M |
| 3300019118 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898) | Environmental | Open in IMG/M |
| 3300019138 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000077 (ERX1782429-ERR1712131) | Environmental | Open in IMG/M |
| 3300019145 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001610 (ERX1809765-ERR1740132) | Environmental | Open in IMG/M |
| 3300019146 | Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5 | Environmental | Open in IMG/M |
| 3300019149 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dT | Environmental | Open in IMG/M |
| 3300019207 | Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019261 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019267 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071402VT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019272 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020013 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021284 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R878 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021298 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.460 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021303 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021308 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.462 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021317 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021342 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021348 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021353 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021856 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021872 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021874 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021877 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-17 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021881 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021885 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021886 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021895 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-13 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021897 | Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021899 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021904 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C1 B9 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021910 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021928 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021929 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - DR:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021930 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022829 | Saline water microbial communities from Ace Lake, Antarctica - #1572 | Environmental | Open in IMG/M |
| 3300023685 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023694 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023698 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023700 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023702 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023706 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023708 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023709 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024532 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024534 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024546 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024547 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024848 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024862 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025757 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300026415 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026448 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026461 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026468 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026495 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028137 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028329 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028334 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028337 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 38R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028396 | Seawater microbial communities from Monterey Bay, California, United States - 55D | Environmental | Open in IMG/M |
| 3300028554 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9) | Environmental | Open in IMG/M |
| 3300028575 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029983 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030551 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030609 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030610 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030611 | Metatranscriptome of decayed wood fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-1 (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300030637 | Metatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 16_T1E_8DEL1 developmental time series (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300030639 | Metatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 20_T1F_StrEL1 developmental time series (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300030699 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030702 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030720 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030721 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030722 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030724 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030786 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030856 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030857 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030859 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030865 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030869 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_S_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030951 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_5 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030957 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_T_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031005 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031006 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_Q_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031113 | Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031121 | Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031335 | Saline water microbial communities from Organic Lake, Antarctica - #374 | Environmental | Open in IMG/M |
| 3300031340 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_322_32.3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031382 | Saline water microbial communities from Organic Lake, Antarctica - #714 | Environmental | Open in IMG/M |
| 3300031445 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031570 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031579 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031594 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_20m | Environmental | Open in IMG/M |
| 3300031674 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031725 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031735 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031737 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031739 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032470 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032491 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032517 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032518 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032521 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032615 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032616 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032617 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032666 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032709 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032714 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032726 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032730 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032733 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032746 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032749 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032754 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300033572 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ocean5-_01658200 | 2166559017 | Environmental And Host-Associated | MVCTCWVDTVFI*DDFPEFSTDLITALTCLDVNEFSHFNDNCYIFKIG |
| JGI24213J29975_10009241 | 3300002341 | Wastewater Treatment | VIGTGWVNSVFIGDDLPELGTDLVTALTTLDVNDFSHSAFK |
| JGI24214J29971_10032701 | 3300002343 | Wastewater Treatment | VIGTGWVNSVFIGDDLPELGTDLVTALTTLDVNDFSHSAFKL |
| JGI24214J29971_10186161 | 3300002343 | Wastewater Treatment | VVGSGGVNSVFVRNNFPEFGSDLVTTLTSLDMYDFSHFIYIFFF |
| JGI24215J29973_10003221 | 3300002345 | Wastewater Treatment | MIGTSWVNSVFIGDDLPELGTDLVTALTTLDVNDFSHSAFKL |
| Ga0006242J48907_1043661 | 3300003292 | Seawater | LEIGITALGSGWVNTVFVRDDFPEFGTDLVSALSSLNMYDF |
| Ga0006244J48909_10029921 | 3300003299 | Seawater | LEIGITALGSGWVNAVFVRDDFPEFGTDLVTALSSLNMYDFSH |
| Ga0006883J46559_10228801 | 3300003307 | Freshwater | MIGSGRVDTVFIRNDFPEFSSDLVTTLSSLNMYDFSHFQISG |
| Ga0008453J51685_1073651 | 3300003555 | Seawater | LEIGITALGSGWVNAVFVRDNFPEFGTDLVTALSSLNMYDF |
| Ga0008455J51687_10005761 | 3300003566 | Seawater | LEIGITALGSGWVNTVFVRYDFPEFGTDLVSALSSLNMYDF |
| Ga0007410J51695_10739341 | 3300003574 | Avena Fatua Rhizosphere | VIGTSGVNTVLVGNDFPELSTDLVTALTSLNVDDFSHGEDISL |
| Ga0008458J53046_1001291 | 3300003677 | Seawater | LEIGITALGSGWVNTVFVRYDFPEFGTDLVSALSSLNMYDFS |
| Ga0008459J53047_10000371 | 3300003683 | Seawater | LEIGITALGSGWVNTVFVRDDFPEFGTDLVSALSSLNMYDFSH |
| Ga0008275_1016721 | 3300003721 | Marine | VIGSGGVNSVFIRDDFPEFGTDLVTALSSLDVNDFSHYVL |
| JGI26437J51864_100686931 | 3300003910 | Freshwater Lake Sediment | VIRTSWVNSVFIGNDLPELGTDLVTALTCLNVDDLSHSIFEY* |
| Ga0007753_14405772 | 3300004786 | Freshwater Lake | VVGSGGVDAVFVGNDFPKLGSDLVSALSCLYVYNFSHRLF |
| Ga0007742_100523361 | 3300004788 | Freshwater Lake | VVGSSWVNSVFIRDDFPEFGSDLITALSSLYVNDLSHCVDLIFSND |
| Ga0007761_100458831 | 3300004792 | Freshwater Lake | VISTGGVDSVFIRDDFPEFSSDLVTTLSSLDMNDFSHFIFVC |
| Ga0007763_100305461 | 3300004796 | Freshwater Lake | VIGSGRVDSVFVGNDFPELGTDLVTALSSLDVNYFSHLFL |
| Ga0082389_1182211 | 3300006229 | Marine | VIRTGRVNTVLIGNDFPELGTHLVTALTCLNVDDLSH |
| Ga0075502_10281383 | 3300006357 | Aqueous | VIGTGWVDTVFVRDNFPEFCSDLVTTLSSLYVYDFSH |
| Ga0075490_10842481 | 3300006375 | Aqueous | VVGTSWVNSVFIRDDFPELGSDLVTALTGLDVYNFTH |
| Ga0075504_10294991 | 3300006383 | Aqueous | VVGTGWVNSVFVGDDFPEFGTDLVTALTTLDVNDFSH |
| Ga0075509_10044362 | 3300006390 | Aqueous | VVGTGWVNSVFVGDDFPEFGTDLVTALTTLDVNDFSHL |
| Ga0075507_10025191 | 3300006392 | Aqueous | MIGSSWVNSVFIRNDFPEFGSDLVTTLSSLYVNDF |
| Ga0075492_10177181 | 3300006394 | Aqueous | VIGSGGVDSVFVRDDFPEFGTNLVTTLSSLNMYDFSHF |
| Ga0075488_10737541 | 3300006397 | Aqueous | LEIGVTALGSGWVNTVFVRDNFPEFGTDLVTALSSLNVYDF |
| Ga0075495_10280773 | 3300006399 | Aqueous | VIGSGGVNSMFIRDDFPEFGTDLVTALTSLNVNDFSH |
| Ga0075503_10615851 | 3300006400 | Aqueous | MIGSSWVNSVFIRNDFPEFGSDLVTTLSSLDVYNFSHFVLLVGLFFLFLLI |
| Ga0102532_11120504 | 3300007094 | Freshwater Lake | MIRTGGVNSVLVGDDLPELGTDLVTALTSLNVDNFSHEFSNKK* |
| Ga0079300_101318052 | 3300007162 | Deep Subsurface | VIGSGWVNSVFIRNYFPEFGSDLVTALSSLYVYDF |
| Ga0114341_102730501 | 3300008108 | Freshwater, Plankton | VVGTGGVNSVFVRDDFPELGTDLVTALASLNVNDFSHFKCVF |
| Ga0114342_100137621 | 3300008109 | Freshwater, Plankton | VVGAGGVDAVLVGDDLPEFGADLVAALTGLDVNDFSHFEFLLFFFLSI* |
| Ga0114354_11128463 | 3300008119 | Freshwater, Plankton | VVGTGGVNSVFVRDDFPEFGSDLVTALTTLDVNDFSHF |
| Ga0103763_10262683 | 3300008796 | Eutrophic Pond | VIGSGRVDSVFVGNDFPELGTDLVTALSSLDVNYFSHLFLFI |
| Ga0103768_10088861 | 3300008801 | Eutrophic Pond | VIGSGRVDSVFVGNDFPELGTDLVTALSSLDVNYFSHLF |
| Ga0103951_103289062 | 3300008832 | Marine | VVGASGVDSMLVRNHFPELSSDLVSALSGLQVNDFSHFDWIVVVE |
| Ga0103883_10000723 | 3300008835 | Surface Ocean Water | MVCTSWIDSVFVGDDFPEFSTDLVTALTSLNVNKFSHLCS |
| Ga0103746_100583331 | 3300008884 | Wastewater Sludge | MIRAGRVNTVFVRDDLPEFSTNLVTALTSLDVDDFSHLF |
| Ga0104259_10212571 | 3300008958 | Ocean Water | LEIGITALGSGWVNTVFVRYDFPEFGTDLVSALSSLNMYDY |
| Ga0103710_100287892 | 3300009006 | Ocean Water | VIGSGGVNTVFVRDYFPEFGTDLVTTLSSLDVYNFSHFYLLVFLFMLFFKI |
| Ga0103848_10153295 | 3300009218 | River Water | MIGTSGVYSVFVRDNFPEFGSNLVTTLTTLDVNDF |
| Ga0103857_100251862 | 3300009235 | River Water | MIGSGWVNSVFIRNDFPEFGSDLVTALSSLNVNDFSH |
| Ga0103860_100103043 | 3300009243 | River Water | VVGTSWVNSVFIRDNFPEFSSDLVTTLSSLDVYDFSH |
| Ga0103860_100779953 | 3300009243 | River Water | VVRTSWVNSVLIRNNLPKFSSDLVTALTSLNVDDFSHFE |
| Ga0103872_10000191 | 3300009263 | Surface Ocean Water | MISSSWINSVFIRNDFPEFGSDLVTALSSLDVNDF |
| Ga0103880_100005243 | 3300009279 | Surface Ocean Water | MVCTSWIDSVFVGDDFPEFSTDLVTALTSLNVNKF |
| Ga0103841_10003521 | 3300009334 | River Water | MVCTSWIDSVFVGDDFPEFSTNLVTALTSLNVNKFSHLFK |
| Ga0103865_10014003 | 3300009352 | River Water | VVGTSWVNSVFIRDDFPEFGTDLVTTLSSLDVNDFS |
| Ga0103847_10004692 | 3300009353 | River Water | MVCTSWIDSVFVGDDFPEFSTDLVTALTSLNVNKFSHL |
| Ga0103827_10005493 | 3300009357 | River Water | MVCTSWIDSVFVGDDFPEFSTDLVTALTSLDVYEFS |
| Ga0103868_10089041 | 3300009384 | River Water | VVGTSWVNSVFIRDDFPEFGTDLVTTLSSLDVNDFSHL |
| Ga0115007_103681931 | 3300009441 | Marine | ITVVGTGGVDTVLVGDDFPEFGTDLVTALTTLDVNDFSLRKGK* |
| Ga0115013_101137423 | 3300009550 | Marine | MISTGWVDTVFIGDDLPEFGTDLVTALTSLDVNEFSHF* |
| Ga0115103_11775961 | 3300009599 | Marine | MIGSGWVNSVFVRDDFPEFGSDLITTLSSLNVYDF |
| Ga0115103_13389571 | 3300009599 | Marine | LEIGITALGSSWVNAVFVRDNFPEFGTDLVTALSSLNM |
| Ga0115103_13606131 | 3300009599 | Marine | MIGTSWVNSVFIGDDFPEFGTDLVTALTALNMYNF |
| Ga0115103_14730471 | 3300009599 | Marine | LEIGITALGSGWVNAVFVRDNFPEFGTDLVTALSSLNVY |
| Ga0115102_102285201 | 3300009606 | Marine | LKIGITALGSGWVNAVFVRDDFPEFGTDLVTALSSLYVYDF |
| Ga0115100_106950744 | 3300009608 | Marine | VICTGWVDTVFI*DDFPEFSTDLVTALSCLDMYEFSHFVILLVI |
| Ga0115105_105809701 | 3300009679 | Marine | MIGTGWVDSVFIRDDFPEFSTDLVTALTSLDVNKFSHF |
| Ga0115105_110120011 | 3300009679 | Marine | MIGSGWVDSVFVRHNFPEFGTDLVTTLTSLDVNDFSHFLFIDLFF |
| Ga0115105_113549051 | 3300009679 | Marine | MIGTCWINTVFIGDDFPEFSTNLVSALTSLDVNKFSHF |
| Ga0123362_11158843 | 3300009739 | Marine | MVCTSWIDSVFVGDDFPEFSTDLVTALTSLNVNKFSHLCSL |
| Ga0123366_10812792 | 3300009756 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSHLCSLK |
| Ga0130078_104462771 | 3300009869 | Rumen | LKIRIAMVGTGWVNAVLIRDDFPEFSTDLVATLSSLDVYNF |
| Ga0123382_11860251 | 3300010135 | Marine | VICTGWVDTVFI*DDFPEFSTDLVTALTSLDVYEFSHCIISIIF |
| Ga0129322_10706961 | 3300010306 | Aqueous | VIGSGWVNSVFVRDDFPEFGSDLVTTLSSLDVNDFSHCFDDFFCV |
| Ga0129322_10793912 | 3300010306 | Aqueous | MVGSGGVNSVFVGNDFPEFGTDLVTALSSLYVYDF |
| Ga0129322_10904451 | 3300010306 | Aqueous | VIGTGRVNSVFIRNNFPEFCSDLVTTLSSLYVYDFSHFRILKNMIILKKF |
| Ga0129319_11015621 | 3300010307 | Aqueous | VIGSGRVDSVFVGNDFPELGTDLVTALSSLDVNYFSHL |
| Ga0138314_10681112 | 3300010974 | Fungi-Associated Bovine Rumen | MVGAGWINAVLIGDNFPEFGTNLVTTLSSLDVYNFTN |
| Ga0138321_102444561 | 3300010980 | Fungi-Associated Bovine Rumen | MVGTSWVNAVFIRDDFPEFGTNLVSALSSLDMNNFTN |
| Ga0138324_100365481 | 3300010987 | Marine | VFIGDDFPEFSTDLVTALTSLNVNKFSHLKSFLVSK |
| Ga0138324_100772213 | 3300010987 | Marine | MICTCWIDSVFIGDDFPEFGTDLITALTSLNVNKFSHLKSFLVSK |
| Ga0138324_102851381 | 3300010987 | Marine | VVCSGWVDTVFI*DDFPEFGTDLVTALSCLDMYEFSHFVFLK |
| Ga0138324_105135691 | 3300010987 | Marine | VVCSGWVDTVFI*DDFPEFGTDLITTLTCLDVNEFSHVCEEL |
| Ga0150979_11168053 | 3300011012 | Marine | VIGSGGVDSMFIRDDFPEFGTNLVTALSSLDVNDFSHFICICRCICI |
| Ga0138579_13383034 | 3300011090 | Peatlands Soil | MIGSSGVYSMFI*NNFPELSSDLVTALSSLDMNDFSHVIVR |
| Ga0123369_10896291 | 3300012370 | Marine | MVCTSWIDSVFVGDDFPEFSTDLVTALTSLNVNKFSHLC |
| Ga0138264_13172721 | 3300012414 | Polar Marine | VIGSGGVNSMFIRDDFPEFGTDLITTLSSLYVNDFSHYIVFL |
| Ga0138264_17290641 | 3300012414 | Polar Marine | VIGSGGVNSVFVRDNFPEFGSDLVTTLSSLDVNDLSHYYFIFFKCL |
| Ga0138263_15103092 | 3300012415 | Polar Marine | VIGSGGVNSVFVRDNFPEFGSDLVTTLSSLDVNDLSHYYFIFFKCLF |
| Ga0138259_16892111 | 3300012416 | Polar Marine | VIGSGGVNSMFVRNDFPEFGSDLVTTLSSLYMNDLSHLFF |
| Ga0138261_11815411 | 3300012418 | Polar Marine | VIGSGGVNSVFVRDDFPEFGTDLITTLSSLDVNDLSHLNFICL |
| Ga0129328_10498751 | 3300012472 | Aqueous | VIGSGGVDSVFVRDDFPEFGTNLVTALSSLDVNDFSHFFLCL |
| Ga0129325_11374861 | 3300012516 | Aqueous | MVGSGGVNSVFVGNDFPEFGSDLVTALSSLNVYDF |
| Ga0129326_10911941 | 3300012522 | Aqueous | VIGSGRVNTVFVRNNFPEFCSDLVTTLSSLYVYDFSHFRILKNMIILKK |
| Ga0129331_12982073 | 3300012524 | Aqueous | VIGSGGVDSVFIRDDFPEFGTNLVTALSSLDVNDFSHFFLCL |
| Ga0157576_11232441 | 3300012700 | Freshwater | VVGTGWVNSVFVRNDLPELGSDLVTALTSLYVNDFSH |
| Ga0157572_10207441 | 3300012703 | Freshwater | MIGSGWVNSVFIRDDFPEFSSDLITALSSLYVNDLSHLFFL |
| Ga0157627_10850911 | 3300012706 | Freshwater | VVGTGGVNSVFVRDDFPELGTDLVTALTSLNVNDFSHFKCV |
| Ga0157623_11277751 | 3300012707 | Freshwater | MIGSGWVNSMFIRDDFPEFGTNLVTALSSLDVYYF |
| Ga0157595_12261261 | 3300012708 | Freshwater | VVGSSWVDSVFIRNDFPEFGSDLVTALSSLYVNDLSHFF |
| Ga0157607_10256501 | 3300012711 | Freshwater | VIGSGWVNSVFIRNYFPEFGSNLVTALSSLYVYDF |
| Ga0157601_11016431 | 3300012714 | Freshwater | VVGTGGVNSVFVRDDFPELGTDLVTALTSLNVNDFSHFKC |
| Ga0157601_11432483 | 3300012714 | Freshwater | MIGTSGVYSVFVRDNFPEFGSDLVTTLTALDVNDFSHLK |
| Ga0157601_11926664 | 3300012714 | Freshwater | MIRAGRVNSVLVRDDLPELGTDLVTALSSLYVNDFSHEFK |
| Ga0157605_11448391 | 3300012716 | Freshwater | MIRAGRVNSVLVRDDLPELGTDLVTALSSLYVNDFSHEF |
| Ga0157609_11296483 | 3300012717 | Freshwater | MIGTSGVYSVFVRDNFPEFGSDLVTTLTTLDVNDFSHL |
| Ga0157611_10830263 | 3300012724 | Freshwater | VVGTGGVNSVFVRDDFPELGTDLVTALTSLNVNDFSHFK |
| Ga0157552_12289313 | 3300012728 | Freshwater | VVSSGRVDSVFVRNDLPKLGTDLVTALTSLHVNDF |
| Ga0157625_10655052 | 3300012729 | Freshwater | VIGSGRVDSVLVGNNLPEFSSDLVTALSCLNVNDF |
| Ga0157616_11281871 | 3300012731 | Freshwater | VISTGGVDSVFIRDDFPEFSSDLVTTLSSLDMNDFSHFIYVCRFF |
| Ga0157616_12831861 | 3300012731 | Freshwater | MIGTSGVYSVFVRDNFPEFGSDLVTTLTALDVNDFSHLKMFF |
| Ga0157537_1105162 | 3300012738 | Freshwater | MVSSGRVDSVFVRNDLPKLGTDLVTALTSLHVNDF |
| Ga0138277_10840931 | 3300012751 | Freshwater Lake | VISSGWVDSVFIGNDFPELGTDLVTALTSLNVNDFSH |
| Ga0138277_11191661 | 3300012751 | Freshwater Lake | VVGTGGVNSVFVRDDFPEFGSDLVTALTTLDVNDFSHFKK |
| Ga0157629_10608251 | 3300012752 | Freshwater | VVGTGGVNSVFVRDDFPELGTDLVTALTSLNVNDF |
| Ga0138278_10855571 | 3300012754 | Freshwater Lake | VVGTGRVNSVFVRNDFPELGSDLVSALTCLNVNYFSH |
| Ga0138278_11609971 | 3300012754 | Freshwater Lake | VVGTGGVNSVFVRDDFPEFGSDLVTALTTLDVNDFSHFKKFV |
| Ga0138272_11816591 | 3300012756 | Freshwater Lake | MISSGWVNSVFIRNDFPKFGSYLITALSSLNVYNF |
| Ga0138285_11023962 | 3300012758 | Freshwater Lake | VVGTSWVNTVFIGNDFPELGSDLVTALTGLDVYNF |
| Ga0157626_10853421 | 3300012759 | Freshwater | MIGSGWVNSMFIRDDFPEFGTNLITALSSLDVYYF |
| Ga0138273_10702491 | 3300012760 | Freshwater Lake | VVGTGRVNSVFVRNDFPELGSDLVSALTCLNVNYFSHL |
| Ga0138276_10570011 | 3300012768 | Freshwater Lake | VIGSGWVNSVLIRDDFPEFGTNLVTTLSSLDVYYF |
| Ga0138276_10900851 | 3300012768 | Freshwater Lake | VVGTGRVNSVFVRNDFPELGSDLVSALTCLNVNYF |
| Ga0138279_10135542 | 3300012769 | Freshwater Lake | MVGSGWVNSVFI*NDFPKFSSDLISALSCLNVHYF |
| Ga0138287_11421704 | 3300012772 | Freshwater Lake | VVGTSWVNSVFIRDDFPEFSTDLVTALAGLDVNDFSHLKK |
| Ga0138257_16798041 | 3300012935 | Polar Marine | VIGSGGVNSMFVRDDFPEFGTDLVTTLSSLDVNDFSHLCL |
| Ga0157620_11418494 | 3300012959 | Freshwater | VIGSGWVNSVLIRDDFPEFGTNLVTALSSLDVYYF |
| Ga0129341_12616411 | 3300012966 | Aqueous | MVGTSRVNSMFVRDDFPELGTDLVTALTSLDVDDL |
| Ga0129332_11859383 | 3300012969 | Aqueous | VIGSGGVDSVFIRDDFPEFGTNLVTALSSLDVNDFSHFFLCLRF |
| Ga0164292_106938361 | 3300013005 | Freshwater | VIGSGWVNSVFIRNYFPEFGSDLVTALSSLYVYDFSHFKFNY |
| Ga0170791_108880081 | 3300013295 | Freshwater | MIGSGWVNSVFIRDDFPEFCSDLVTTLTSLYVYDFSHF |
| Ga0170791_113518171 | 3300013295 | Freshwater | VVGSGRVDSVFVRNDLPEFGSDLVTALSCLNVNDF |
| Ga0170791_121712431 | 3300013295 | Freshwater | VIGSGWVNSVFIRNDFPEFGSDLVTALSSLYVYDF |
| Ga0170791_124672762 | 3300013295 | Freshwater | VIGSGWVNSVFVRNDFPEFSSDLVTALSSLNVNDF |
| Ga0157622_10294032 | 3300013310 | Freshwater | VVGTGGVNSVFIRDDFPELGTDLVTALTSLNVNDFSHFK |
| Ga0173629_100101631 | 3300013313 | Marine | VIGSGGVDSMFIRDDFPEFGTNLVTALSSLDVNDFSHFICICRC |
| Ga0180043_1053152 | 3300016681 | Freshwater | MIRAGRVNSVLVRDDLPELGTDLVTALSSLYVNDF |
| Ga0180039_11179841 | 3300016688 | Freshwater | VVGAGRVNAVLIGDDLAELGTDLVAALASLNVNDLTHCV |
| Ga0180058_12071173 | 3300016699 | Freshwater | VISTSGVNSVFIRDDFPEFGTDLVTTLSSLDMNDFS |
| Ga0182045_10099962 | 3300016726 | Salt Marsh | MIGSGWVNSVFVRDDFPEFGSDLITALSSLYVNDFSHFGIC |
| Ga0182045_12952712 | 3300016726 | Salt Marsh | VISSGGVDSVFIRDDFPEFGTNLITALSSLDVNDF |
| Ga0182051_10226981 | 3300016727 | Salt Marsh | MIGSGWVNSVFVRDDFPEFGSDLITALSSLYVNDFSHFGI |
| Ga0182051_12856931 | 3300016727 | Salt Marsh | VISSGGVNSVFIRDDFPEFGTDLITALSSLDMNDF |
| Ga0182051_13081141 | 3300016727 | Salt Marsh | VIGSGGVNSVFIRDDFPEFGTDLVTTLSSLDVNDFSHFMYV |
| Ga0182052_10501442 | 3300016742 | Salt Marsh | MIGSGWVNSVFIRNDFPEFSSDLVTTLSSLNVYDF |
| Ga0182043_10274281 | 3300016748 | Salt Marsh | VISTGGVDSMFVRDDFPEFGTDLVTALSSLDVNDFSHFVLDI |
| Ga0182043_11946181 | 3300016748 | Salt Marsh | MIGSSWVNSMFIRNDFPEFGSNLVTALTALNVNDFSHLFKIFKIF |
| Ga0182043_13365193 | 3300016748 | Salt Marsh | MIGSGWVNSVFVRDDFPEFGSDLITTLSSLYVNDFSHFGICI |
| Ga0182053_11407151 | 3300016749 | Salt Marsh | VIGSGGVNSVFIRDDFPEFGTDLITALSSLDMNDFSHFLFQ |
| Ga0182072_10419751 | 3300016754 | Salt Marsh | VIGTGGVNSVFIRDDFPEFGTDLVTTLSSLDVNDFSHFMYVF |
| Ga0182084_14663292 | 3300016762 | Salt Marsh | MVGSGWVNSVFVGNDFPEFSTDLVTALTSLNVNDFSHCDLK |
| Ga0182091_13231531 | 3300016766 | Salt Marsh | MIGSGWVNSVFVRDDFPEFGSDLITALSSLYVNDFSHFGICIFI |
| Ga0182063_13401582 | 3300016781 | Salt Marsh | VVGTGRVNSVFVRDDFPEFGTDLVTALSALDVNDF |
| Ga0193019_1007231 | 3300018537 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSHLC |
| Ga0188826_1024381 | 3300018565 | Freshwater Lake | VVGSGGVNSVFVRDNLPEFSSDLVTALSSLNVYDFSHLK |
| Ga0188842_10005821 | 3300018574 | Freshwater Lake | LEIGITALGSGWVNTVFVRDDFPEFGTDLVSALSSLNVY |
| Ga0193510_10015741 | 3300018580 | Marine | VVGSGGVDSVFIRNDFPEFSSDLVTALSSLDVNDFSHFYLVIFSEFFLFF |
| Ga0192844_10015862 | 3300018593 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSHLCSLLFKSLKVPH |
| Ga0188834_10035741 | 3300018599 | Freshwater Lake | VVGSGGVNSVFVRDNLPEFSSDLVTALSSLNVYDFSHLKLL |
| Ga0188834_10040731 | 3300018599 | Freshwater Lake | MIGSGWVNSVFVRDDFPEFGSDLITALSSLYVNDFSHFGICIF |
| Ga0188834_10100753 | 3300018599 | Freshwater Lake | MIGSGWVNSVFVRDDFPEFGSDLITTLSSLYVNDLSHFGICIF |
| Ga0188850_10011443 | 3300018601 | Freshwater Lake | MVGTSWVNSVFVRDDFPEFSTNLVTTLTSLNVNDF |
| Ga0188850_10011461 | 3300018601 | Freshwater Lake | MVSTSWVNSVFVRNDFPEFGTDLVSALSSLDMNDF |
| Ga0188850_10020723 | 3300018601 | Freshwater Lake | VIGTGGVNSVFVGNDFPEFSSDLVSALSSLDMNDFS |
| Ga0188821_10021984 | 3300018607 | Freshwater Lake | VVGTGGVNSVFVRDDFPEFGSDLVTALTTLDVNDFSHFKKF |
| Ga0188884_10022081 | 3300018610 | Freshwater Lake | VIRTGGVDSVLVRDDLPELGTDLVTALTSLNVDNFSHEFSNK |
| Ga0188846_10051621 | 3300018614 | Freshwater Lake | VIGSGGVNAVFIRNYFPKLSSYLVSALSCLYVNDFSH |
| Ga0188846_10057262 | 3300018614 | Freshwater Lake | VVGSGGVNSMFVRDDFPEFGTDLITALSSLDVNNFSHFFFIFF |
| Ga0193093_10096001 | 3300018621 | Marine | VVGSSGVDSVFVRDDLPEFGSDLVAALAALYVNYFSHLLFLFFP |
| Ga0188875_10047501 | 3300018629 | Freshwater Lake | LEIGITALGSGWVNTVFVRDDFPEFGTDLVSALSSLNV |
| Ga0188880_10037931 | 3300018640 | Freshwater Lake | VIGSGGVDSVFIRDDFPEFGTNLVTTLSSLDVNDFSHFISFGC |
| Ga0193110_10183242 | 3300018696 | Marine | VVDTGGVNSVFVRNNFPEFGSDLVTTLSSLDVNDFS |
| Ga0193439_10031761 | 3300018702 | Marine | VVGSGGVNSVFVRNNFPEFSSDLVSALSSLDVNDFSHFSNYVLLKVFLIF |
| Ga0192984_10199751 | 3300018710 | Marine | VIGSGGVNSMFVRDDFPEFGTDLVTTLSSLDVNDFSHLCLLFIF |
| Ga0193324_10346741 | 3300018716 | Marine | MISTGWVDSVFVGDDFPEFSTDLVTALTSLDVYEFSHCIRIY |
| Ga0193391_10060693 | 3300018724 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSHFNVVI |
| Ga0193517_10172972 | 3300018725 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLDVYEFSHLCSLLFKSLKVPH |
| Ga0193381_10073412 | 3300018732 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSHL |
| Ga0192879_10279651 | 3300018736 | Marine | MIRTSWVNTMFIRNNFPEFSTNLVTTLPSLDVNDFSHL |
| Ga0193138_10164582 | 3300018742 | Marine | VVCTGRINSVFIGNDFPELGTDLVTALTSLDVNDFSHFDLYAF |
| Ga0193138_10244381 | 3300018742 | Marine | VIGSGRVDSMFIRDNFPEFGTDLVTTLSSLDVNDFSHFE |
| Ga0193000_10069653 | 3300018745 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSHLCSLKFKSYKKFFS |
| Ga0193468_10098121 | 3300018746 | Marine | VICTGWVDTVFIXDDFPEFSTDLVTALSSLDMYEFSHL |
| Ga0193346_10437072 | 3300018754 | Marine | MIGTGWVDSVFIRDDFPEFSTDLVTALTSLDVYEFSHF |
| Ga0193063_10147903 | 3300018761 | Marine | VVGSGGVNSVFVRNDFPEFSSDLVSALSSLDVNDF |
| Ga0193063_10274262 | 3300018761 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSHLCSLL |
| Ga0193181_10055863 | 3300018766 | Marine | VICTSWVDTVFVRDDFPEFSTDLVTALTSLDVYEFSHCIISIIF |
| Ga0193181_10059343 | 3300018766 | Marine | MISTGWVDTVFIGDDLPEFGTDLVTALTSLDVNEFS |
| Ga0193181_10062253 | 3300018766 | Marine | MVCTCWIDSVFIGDDFPEFGTDLITALTSLNVNKFSHL |
| Ga0193181_10263491 | 3300018766 | Marine | MICTSWVNTVFIGNDFPEFGTDLVTTLTSLDVNKFSHI |
| Ga0193503_10085943 | 3300018768 | Marine | VISTGWVDTVFVRDDFPEFSTDLVTALTSLDVYEFSHFVL |
| Ga0193314_10547851 | 3300018771 | Marine | VVGTCWVNSVLVRDDLPELCTNLVSALTCLDVDDFSHGILRV |
| Ga0192824_10218311 | 3300018801 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSHLCS |
| Ga0193422_10143191 | 3300018810 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKF |
| Ga0193187_10142482 | 3300018817 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSHLCSLKFK |
| Ga0188874_10256303 | 3300018824 | Freshwater Lake | MIGSGWVNSVFVRDDFPEFGSDLITTLSSLYVNDLSHFF |
| Ga0188874_10256391 | 3300018824 | Freshwater Lake | VIGSGWVNSVFVRDDFPEFGSDLITTLSSLYVNDLSHFF |
| Ga0193048_10347162 | 3300018825 | Marine | VVSTGRVNTVFIGDNLPELGTDLVTALTTLDVNDFS |
| Ga0193219_10105132 | 3300018842 | Marine | MVCTSWIDSVFVGDDFPEFSTDLVTALTSLNVNKFSH |
| Ga0193219_10119151 | 3300018842 | Marine | VIGSGGVNTVFVXDNFPKFGTDLVTTLSSLDVYDFSHFMMNYLLFFLIFVFLCL |
| Ga0193090_10715401 | 3300018899 | Marine | LVRTGGVNTVLVGDDFPELGTYLVTALTSLNVNDF |
| Ga0193260_100189801 | 3300018928 | Marine | VIGSSGINSVFVRDNFPELSSDLVSTLSGLDMNDF |
| Ga0192961_101680062 | 3300018980 | Marine | MIGSGWVNSVFVRDDFPEFGSDLITTLSSLNVYDFSHFKFIIKNLTISF |
| Ga0193444_100487722 | 3300018998 | Marine | VVGSGGVNSVLIGDDFPEFGSNLVTALASLKVNNLSHV |
| Ga0193034_100051351 | 3300019001 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSHLCSLLFKSLKVPM |
| Ga0193154_100595881 | 3300019006 | Marine | MVRTSGVNTMFVGNNFPELGSDLVTTLTSLDVNDFSHMXIPH |
| Ga0193555_100537791 | 3300019019 | Marine | VVGSGGVNSVFVRNNFPEFSSDLVSALSSLDVNDFSHFSNYVLLKVFFNFFF |
| Ga0192869_100420051 | 3300019032 | Marine | VIGSGGVDSVFIXDDFPEFGTDLVTALSSLDVDDFSHFVLDIFEFCIPH |
| Ga0188830_10018981 | 3300019085 | Freshwater Lake | VVGSGGVNSVFVRDNLPEFSSDLVTALSSLNVYDFSHLKL |
| Ga0193243_10036801 | 3300019116 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSHLCSLLFKSLKVP |
| Ga0193157_10093261 | 3300019118 | Marine | MIGTSRVNSVFIGDDFPELSTNLVTALTTLDVNDFSHLK |
| Ga0193216_101557261 | 3300019138 | Marine | MVGTSWVNSVFVGDDFPEFSTNLVTALTGLKVDNLSHICFSLKLKIPMYSALI |
| Ga0193288_10069453 | 3300019145 | Marine | VISTGWVDTVFVRDDFPEFSTDLVTALSCLDVNEFSHFGV |
| Ga0188881_100349791 | 3300019146 | Freshwater Lake | LEIGITALGSGWVNAVFVRDNFPEFGTDLVTALSSL |
| Ga0188870_100988222 | 3300019149 | Freshwater Lake | VISTSWVNSVFVRNDFPEFSTNLVTTLSSLNVNDF |
| Ga0180034_11012273 | 3300019207 | Estuarine | VIRAGGVNSVFVGNDLPELGTDLVTALTSLDVNDLS |
| Ga0182097_13421631 | 3300019261 | Salt Marsh | VIGSGWVNSVFVRDDFPEFGSDLITALSSLYVNDFSHFLIF |
| Ga0182069_14546612 | 3300019267 | Salt Marsh | MVGSGWVNSVFVGNDFPEFSTDLVTTLSTLYMYDF |
| Ga0182059_11779621 | 3300019272 | Salt Marsh | VISSGGVNSVFIRDDFPEFGTDLVTTLSSLDVNDFSHF |
| Ga0182058_15349763 | 3300019283 | Salt Marsh | MIGSGWVNSVFIXDDFPEFGSDLVTTLSSLNVYDF |
| Ga0182086_10262321 | 3300020013 | Salt Marsh | MIGSGWVNSVFVRDDFPEFGSDLITALSSLYVNDFSHF |
| Ga0182086_11023072 | 3300020013 | Salt Marsh | VIGTGGVNSVFIRDDFPEFGTNLVTTLSSLDVNDFS |
| Ga0182044_10035631 | 3300020014 | Salt Marsh | VIGSGGVNSVFIRDDFPEFGTDLVTTLSSLDVNDF |
| Ga0182044_10078813 | 3300020014 | Salt Marsh | VIGSGWVNSVFVRDDFPEFGSDLVTTLSSLNVYDF |
| Ga0182044_10138181 | 3300020014 | Salt Marsh | MIGSGWVNSVFVRDDFPEFGSDLITTLSSLYVNDLSHFGICI |
| Ga0182044_11495181 | 3300020014 | Salt Marsh | VISSGGVDSVFIRDDFPEFGTNLITALSSLDVNDFSHFL |
| Ga0206356_101295231 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSSGGVDSVFIRDDFPEFSTDLVTALTSLDVDDFSH |
| Ga0194118_101038692 | 3300020190 | Freshwater Lake | MIRTGGVNSVLVGDDLPELGTDLVTALTSLNVDNFSHEFSNKK |
| Ga0194116_101192121 | 3300020204 | Freshwater Lake | VVGTGGVNAVFVGNNLPELGTDLVTALTGLNMDDFSHNSVINYK |
| Ga0211731_106762857 | 3300020205 | Freshwater | VIRAGGVDSVLVGDDLPEFGTDLVTTLSALYVNNFSHEFKRL |
| Ga0206687_10313121 | 3300021169 | Seawater | MVGSGWVNSVLVGDDLPEFGTNLVTALTSLNMNDFSHFMCL |
| Ga0206687_13555623 | 3300021169 | Seawater | VIGSGGVNSVFVRDNFPEFSSDLVTTLSSLDMYDFSHFFFPKFFIL |
| Ga0206687_16263511 | 3300021169 | Seawater | VIGSGRVDSVFIRDNFPEFGSDLVTTLSSLDVYDFSHF |
| Ga0210299_1308911 | 3300021284 | Estuarine | VIGSGRVNTVFIGNNFPEFCSDLITTLSSLYVYDFSHFKIFKI |
| Ga0210299_1770492 | 3300021284 | Estuarine | VVGTGGVDSVLIRNNLPELGSDLVTALTSLKMNDFSHFEI |
| Ga0210349_11610231 | 3300021298 | Estuarine | VVGSGGVNSVFVRDDFPKFGSDLVSALSGLDVNDFSHFFFLKL |
| Ga0210308_10507641 | 3300021303 | Estuarine | LEIGITALGSGWVNTVFVRYDFPEFGTDLVSALSSLNMYDL |
| Ga0210350_10301521 | 3300021308 | Estuarine | VVGSGGVNSVFVRDDFPKFGSDLVSALSGLDVNDFSHFF |
| Ga0210309_11739601 | 3300021317 | Estuarine | LEIGITALGSGWVNAVFVRDNFPEFGTDLVTALSSLN |
| Ga0206691_10890291 | 3300021342 | Seawater | VVRSGGVNSVFIGNDFPEFSTNLVTALAGLNVNNFSHMK |
| Ga0206691_17430601 | 3300021342 | Seawater | MIGTSGVNSVLIGDDFPELGTDLVTALTTLDMNDFSH |
| Ga0206695_13894021 | 3300021348 | Seawater | VVSTSGVNTMFIXDDFPEFGSDLISALSSLNVYDF |
| Ga0206692_10158181 | 3300021350 | Seawater | VVGSGGVNTVFIRDDFPEFGTDLVTTLSSLDVYDFSH |
| Ga0206693_15629381 | 3300021353 | Seawater | MVCTGRVDSVFIRDDFPEFRTNLVSALPCLYVNNFPHGQLPFVLSKDD |
| Ga0213850_11193261 | 3300021856 | Watersheds | VVGTGWVNTVLVGNDFPEFGTDLVTALSSLDVNDFSHFF |
| Ga0063132_1156841 | 3300021872 | Marine | MISTGWVDTVFIGDDLPEFGTDLVTALTSLDVNEFSHFP |
| Ga0063147_1011701 | 3300021874 | Marine | MVCTGRVDSVFIRDDFPEFGTDLVTALTCLDVDEFSHYYRIKF |
| Ga0063123_10009951 | 3300021877 | Marine | MISTGWVDTVFIGDDLPEFGTDLVTALTSLDVNEFSHF |
| Ga0063117_10068781 | 3300021881 | Marine | VISTGWVDTVFVRDDFPEFSTDLVTALTSLDVYEFSHF |
| Ga0063125_10161921 | 3300021885 | Marine | MIGTCWIDTMFIGYHFPEFSTDLVTTLSSLDMNKFSHISLASI |
| Ga0063114_10265901 | 3300021886 | Marine | MICTCWIDSVFIGDDFPEFGTDLITALTSLNVNKFSHLKS |
| Ga0063120_10119951 | 3300021895 | Marine | MISTGWVDTVFIGDDLPEFGTDLVTALTSLDVNEFSHFLL |
| Ga0063873_10009311 | 3300021897 | Marine | VVSTSWVNSVFVGDDFPELGTDLVTALTTLDVNDFSHCVV |
| Ga0063144_10133941 | 3300021899 | Marine | VICTGWVDTMFIRDDFPEFSTDLVTTLSCLDVNEFSHFSFLVNY |
| Ga0063144_10135341 | 3300021899 | Marine | MICTSWVDSVFVRDDFPEFSTDLVTALTSLDVNEFSHFKFFVLF |
| Ga0063131_10060131 | 3300021904 | Marine | MISTGWVDTVFIGDDLPEFGTDLVTALTSLDVNEFSHFLKIFK |
| Ga0063100_10006881 | 3300021910 | Marine | VIGSGGVNSVFVRDNFPEFGTDLVTTLSSLDVNDFSHFIIVFFSYLV |
| Ga0063134_10727361 | 3300021928 | Marine | VIGTGRIDSVFIRDDFPEFGTNLVTALTCLDVNEFSHFLLLFV |
| Ga0213845_10968801 | 3300021929 | Watersheds | MLCSGGVNSVLVRNDFPKLSSDLVSALSCLNVNDFSHFSLKRSY |
| Ga0063145_10021441 | 3300021930 | Marine | MVCTGRVDSVFIRDDFPEFGTDLVTALTCLDVDEFSHYYRIK |
| Ga0242662_103225781 | 3300022533 | Soil | VIGSSWVYSVLIRDDLPEFSTDLVSALTTLNVNDFSH |
| Ga0222706_10177111 | 3300022829 | Saline Water | VVGTSWVNTMLVGDNLPELGTDLVTALSSLNVNDLSHVIFKFL |
| Ga0228686_10160033 | 3300023685 | Seawater | MIGSGRVNSVFIRDDFPKFGTDLVTTLSGLNVNDFS |
| Ga0228683_10317621 | 3300023694 | Seawater | LEIGITALGSSWVNAVFVRYDFPEFGTDLVTALSSLNMYDF |
| Ga0228682_10587982 | 3300023698 | Seawater | VVSTSGVNTMFIXDDFPEFGSDLISALSSLDVNDF |
| Ga0228707_10083031 | 3300023700 | Freshwater | MIGSGWVNTMFIXNDFPEFGSNLVTTLTSLDVNDFSHIYILYIIYNYXIXIY |
| Ga0232119_10753361 | 3300023702 | Seawater | LEIGITALGSSWVNAVFVRDNFPEFGTDLVTALSSLNMYDF |
| Ga0232123_10453872 | 3300023706 | Salt Marsh | MVGTGWVYTMLITDNFPELSTNLVTALTSLNVNDFSHFFML |
| Ga0228709_11332671 | 3300023708 | Freshwater | VIGSCGVNSVFITDYFPEFGSNLVTTLSSLDVNDFSHFLFLCL |
| Ga0232122_10411981 | 3300023709 | Salt Marsh | VIGSGGVNSVFIRDDFPEFGTDLVTTLSSLDVNDFSHFMYVCL |
| Ga0255224_10168021 | 3300024483 | Freshwater | MIGSGWVNSVFIRNDFPKFGSDLVTTLSCLYVYDFSHFFEVF |
| Ga0255224_10711043 | 3300024483 | Freshwater | VIGSGWVNSVFIRDDFPEFGSDLVTTLSSLYVNDFSHCICIFF |
| Ga0255228_10445511 | 3300024531 | Freshwater | MIGSGWVNSVFIRDDFPEFCSDLVTTLTSLYVYNFSHF |
| Ga0256352_10113081 | 3300024532 | Freshwater | MVSSCRVNSVFIRDDFPEFGSDLVTTLSSLDVNDFSH |
| Ga0256352_10465892 | 3300024532 | Freshwater | MIGTSWVNSVFIRNNFPEFCSDLITALSSLNMNYFSHFNDFSKKLIK |
| Ga0256357_10171491 | 3300024534 | Freshwater | VVGSGGVNSVFVRDNFPEFGSDLVTTLSSLDVYDFSHCVDIFFFIAF |
| Ga0256338_10202291 | 3300024536 | Freshwater | VIGTSWVNSVFIRDDFPEFGSNLVTALSSLNVNDFSHLDLMF |
| Ga0256356_10689871 | 3300024546 | Freshwater | MVSSCRVNSVFIRDDFPEFGSDLVTTLSSLDVNDF |
| Ga0255292_10239382 | 3300024547 | Freshwater | MVSSCRVNSVLIRDDFPEFGSDLVTTLSSLDVNDFSHLFIFEFRKKFE |
| Ga0255292_10413781 | 3300024547 | Freshwater | VVGSGGVNSVFVRDNFPEFGSDLVTTLSSLDVYDFSHCVRCFFFEA |
| Ga0255292_11076592 | 3300024547 | Freshwater | MIGSCRINSVFITDNFPEFGSDLVTTLSSLDVNDFSHLFY |
| Ga0256302_11480161 | 3300024571 | Freshwater | VVGSSWVDSVFIRNDFPEFGSDLVTALSSLYVNDF |
| Ga0256337_11049302 | 3300024573 | Freshwater | VIRTSWVNSVFIRNDFPEFSSDLVTALSGLDVDDFSHFKDLEKL |
| Ga0255229_10129861 | 3300024848 | Freshwater | VIGSGWVNSVFIRDDFPEFSSDLVTTLSSLDMNDFSHFIF |
| Ga0256317_10774151 | 3300024862 | Freshwater | VVGSSWVDSVFIRNDFPEFGSDLVTALSSLYVNDLSH |
| Ga0256317_11261501 | 3300024862 | Freshwater | MVGSGGVNSVFVRNDFPEFGSDLVTALSSLYVNDLSH |
| Ga0255246_11546182 | 3300024863 | Freshwater | VIGTSWVNSVFIRNDFPEFCSDLVTTLSSLYVYDFSHFKDFEKKMIN |
| Ga0256340_10268111 | 3300024865 | Freshwater | MIGTSWVNSVFVTDDFPEFGTDLVTTLSSLDVNNFSHFFETLKF |
| Ga0256313_10414431 | 3300025757 | Freshwater | VIGSGWVNSVFIRDDFPEFGSDLVTTLSSLYVNDLSHFFMI |
| Ga0209199_11416122 | 3300025809 | Pelagic Marine | MIGSSWVNSMFIRNDFPEFGSNLVTTLTSLNVYDFSHFEI |
| Ga0256298_10162221 | 3300026415 | Freshwater | VVGSSWVDSVFIRNDFPEFGSDLVTALSSLYVNDLSHFFMI |
| Ga0247594_10724471 | 3300026448 | Seawater | VVGSGGVNSVFVRDDFPEFGSDLVTALSSLYVNDFSHFVL |
| Ga0247600_10320211 | 3300026461 | Seawater | MIGSGRVNSMFIGDDFPKFSTNLVTTLTSLNVNDFSHFLL |
| Ga0247603_10365413 | 3300026468 | Seawater | VIGSGWVNSVFVRGDFPEFGSDLITALSSLYVNDFSHFLIFQMSTLTK |
| Ga0247571_10588061 | 3300026495 | Seawater | VISTSRVNSMFIRDDFPEFGTDLVTTLSSLDVNDFSHFICIY |
| Ga0255269_12010761 | 3300026573 | Freshwater | MIGTSWVNSVFIRDDFPELGSDLVTTLASLYVNYFSHF |
| Ga0209404_112138241 | 3300027906 | Marine | VVCSGWVDTVFIXDDFPEFSTDLVTALSCLDMYEFSHFVFLLDIKFEF |
| Ga0256411_10640331 | 3300028134 | Seawater | LEIGITALGSGWVNTVFVRYDFPEFGTDLVSALSSLNVYD |
| Ga0256412_12873311 | 3300028137 | Seawater | VIGSGWVNSVFVRDDFPEFGSDLITTLSSLYVNDLS |
| Ga0256417_11463551 | 3300028233 | Seawater | LQIGITALGSGWVNAVFVRDDFPEFGTDLVTALSSLYVYDF |
| Ga0256417_12222621 | 3300028233 | Seawater | MISTGWVDTVFIGDDLPEFGTDLVTALTSLDVNEFSHLFLY |
| Ga0256413_10776491 | 3300028282 | Seawater | VIGSGWVNSVFVRDDFPEFGSDLITTLSSLYVNDLSHFFV |
| Ga0256413_11377061 | 3300028282 | Seawater | VISSGRVNSMFIRDDFPEFGTDLVTALSSLDVNDFSHF |
| Ga0210315_10102863 | 3300028329 | Estuarine | VVGSGWVNSVFIRNDFPELGTDLVSALTTLDMNDFTHSM |
| Ga0210315_10322411 | 3300028329 | Estuarine | MIGTGWVNSVFIRNDFPEFCSDLVTTLSSLYVYDFSHF |
| Ga0247597_10533901 | 3300028334 | Seawater | VIGSGRVNSVFIRDDFPKFSTDLVTTLSGLNVNDFSHY |
| Ga0247597_10586882 | 3300028334 | Seawater | MVSTSWVNTVFIXDDFPEFGSDLISALSSLNVYDF |
| Ga0247579_10469281 | 3300028337 | Seawater | MVSTSGVNTVFIXDDFPEFGSDLISALSSLNVYDF |
| Ga0228643_11520292 | 3300028396 | Seawater | MVSTSRVNTVLIXNDFPEFGSDLISALSSLDVNNFSHILLLVFKYLF |
| Ga0302047_106061291 | 3300028554 | Soil | MVGSSRIDSVFIRDDLPKFGSDLVTTLSSLNVNDFSHF |
| Ga0304731_102939741 | 3300028575 | Marine | VIGTCWVDTVFIRDDFPEFCTNLVSALTGLNVNKFSHLNVVIVKIN |
| Ga0304731_105814741 | 3300028575 | Marine | VVGSGGVNSVFVGNNFPEFGSDLVTTLSSLDVYDFSHFFLAFIRVVFF |
| Ga0272412_11090731 | 3300028647 | Activated Sludge | MVGSGWVDTVFVGDNFPEFSSNLVPALSSLNVYNFS |
| Ga0311346_110320271 | 3300029952 | Bog | VISSGGVDSVLVRDDFPELSSDLVTALAGLNVNDLSHCDDGW |
| Ga0302284_10907881 | 3300029983 | Fen | MVGTSGVDSVFVRNDLPELSTDLVTALTTLNVNDFSH |
| Ga0311360_102762951 | 3300030339 | Bog | MVGTSGVDSVFVRNDLPELSTDLVTALTTLNVNDFSHLLDFLCVFF |
| Ga0247638_11649811 | 3300030551 | Soil | MVGTGGVDTVLIXNDFPEFGSDLVTALSSLDMNDFSH |
| Ga0247634_100195811 | 3300030609 | Soil | MIGTSWVDSVFIRDNFPELSTDLVTTLTSLDVNYFS |
| Ga0247613_102501101 | 3300030610 | Soil | MIGSGGVNSMFIRNNFPEFGSDLVTTLSSLYVYNFSHVY |
| Ga0257182_10191821 | 3300030611 | Host-Associated | MIGSSGVDSMFIGNDFPELRSDLVPALPRLNANKFTHRSE |
| Ga0187741_1481461 | 3300030637 | Host-Associated | VIGSGGVNTVFVRDYFPEFGTDLVTTLSSLDVYNFSHFVSIGLVFIFFYE |
| Ga0187745_10229151 | 3300030639 | Host-Associated | VIGSGGVNTVFVRDYFPEFGTDLVTTLSSLDVYNFSHFYLLVFLFMLF |
| Ga0307398_101845851 | 3300030699 | Marine | VISTGRIDSMFIRNDFPEFSTDLITALTCLDVDEFTHVWIYLE |
| Ga0307399_102380831 | 3300030702 | Marine | VVSSGRVNSVFVRDDFPEFGTDLVTTLSSLDVNDFSHFYYISIYFF |
| Ga0308139_10164171 | 3300030720 | Marine | VIGTSWVNTMFIGDDFPEFGTDLVTALTGLNVNDF |
| Ga0308133_10404891 | 3300030721 | Marine | MIGTSWVNTMFVGDDFPEFGTDLVTALTGLDVNDFSH |
| Ga0308137_10782841 | 3300030722 | Marine | MISTCWIDTMFIRNDFPEFSTDLVTALTCLDVDEFSHF |
| Ga0308138_10218211 | 3300030724 | Marine | LEIGITALGSGWVNTVFVRNDFPEFGTDLVSALSSLNMYDF |
| Ga0265459_103358391 | 3300030741 | Soil | MIGSGWVNSVFIRNDFPKLGSDLVTTLSSLYVNNFSHFLYLYFLFSNFEVI |
| Ga0073966_100275521 | 3300030786 | Marine | MISTSWVNSVFIRNDFPEFSSDLVTTLTSLNVNDFSHF |
| Ga0073990_120263131 | 3300030856 | Marine | MVCTCWIDSVFIGDDFPEFGTDLITALTSLNVNKFSH |
| Ga0073981_100058801 | 3300030857 | Marine | VIGTGWVNTVFVGDDLPEFGTDLVTALSSLDVNDFSH |
| Ga0073963_115539861 | 3300030859 | Marine | MISSGWVNSVFVRHNFPEFGTNLVTALTSLDVNDFSH |
| Ga0073972_113824143 | 3300030865 | Marine | VIGSGWVNSVFIRHNFPEFGTDLVTALTSLNVNDFSH |
| Ga0151492_10136701 | 3300030869 | Marine | MVCTSWIDSVFVGDDFPEFSTDLVTALTSLNVNKFSHLCSLL |
| Ga0073937_120891233 | 3300030951 | Marine | MVCTSWIDSVFIGDDFPEFSTDLVTALTSLNVNKFSH |
| Ga0073976_100147691 | 3300030957 | Marine | MVCTCWVDSVFIGDDFPEFGTDLVTALTSLNVNKFSH |
| Ga0073974_10154991 | 3300031005 | Marine | MVCTCWIDSVFIGDDFPEFGTDLITALTSLNVNKFSHLNTF |
| Ga0073973_10053341 | 3300031006 | Marine | MVCTCWIDSVFIGDDFPEFGTDLVTALTSLNVNKFSH |
| Ga0138347_107217951 | 3300031113 | Marine | MIXTSWVNTVFVRDNFPEFSTDLVTTLSSLDVNDFSHNSYV |
| Ga0138345_106192001 | 3300031121 | Marine | MVGSGGVNTVFVGDDFPELGSDLVTALTGLEMDNLSHLCVLLVGV |
| Ga0307951_10694451 | 3300031335 | Saline Water | VVGAGGVDAVFVRDDFPEFGTDLVAALSCLYVNDFSHCEKGKKL |
| Ga0308146_10583751 | 3300031340 | Marine | LEIGITALGSGWVNTVFVRYDFPEFGTDLVSALSSLNVYDF |
| Ga0307971_11177291 | 3300031382 | Saline Water | VVGTSWVNTMLVGDNLPELGTDLVTALSSLNVNDLSHVIFKF |
| Ga0307971_11756171 | 3300031382 | Saline Water | VVGAGGVDAVFVRDDLPEFGTDLVAALSCLYVNDFSHCEKGKKL |
| Ga0073952_100290491 | 3300031445 | Marine | VISSGWVNSVFVRHNFPEFGTNLVTTLTSLNVNDFSH |
| Ga0170820_169850272 | 3300031446 | Forest Soil | MVGARWVNSMLVRDNFPKFGTDLVTALPSLDMNDFTHTFSNKK |
| Ga0170819_115400533 | 3300031469 | Forest Soil | MISTSGVNSMFIGDDFPEFGTDLITALTTLNMNDFSHLIRLI |
| Ga0308144_10120632 | 3300031570 | Marine | LEIGITALGSSWVNTVFVGNDFPEFGTDLVSALSSLNVYDF |
| Ga0308134_10438231 | 3300031579 | Marine | VIGTSWVNTMFIGDDFPEFGTDLVTALTGLNVNDFSHSV |
| Ga0302131_12137201 | 3300031594 | Marine | VIGTSWVNTMFVGDDFPEFGTDLVTALTGLDMNDFSHCVDVFVI |
| Ga0307393_10413221 | 3300031674 | Marine | VIGSGGVNSVFVRDNFPEFGTDLVTTLSSLDVNDFSHFILLLFFYL |
| Ga0307381_100576011 | 3300031725 | Marine | LEVGITALGSGWVNTVFVRDDFPEFSTDLVSALSSLNVYEFSHCLFFVSLK |
| Ga0307394_100794641 | 3300031735 | Marine | VIGSGGVNSVFVRDNFPEFGTDLVTTLSSLDVNDFSH |
| Ga0307387_101302451 | 3300031737 | Marine | VVGSGWVNSMFVGDNLPEFSSHLISTLSSLDMNDFSHLLSFWFF |
| Ga0307387_106131261 | 3300031737 | Marine | VISSGGVNSVFIRNNFPEFGTDLVTALSSLNVYDF |
| Ga0307383_100882701 | 3300031739 | Marine | VIGSGRVNSVFIXHDFPEFGTDLITTLSSLDMYKFSHFFLFI |
| Ga0314670_106344651 | 3300032470 | Seawater | LQIGITALGSGWVNTVFVRDDFPEFGTDLVSALSSLNVYDF |
| Ga0314675_104217972 | 3300032491 | Seawater | LEIGIAALGSGWVNTVFVRDYFPEFGTDLVSALSSLNMYDF |
| Ga0314688_104007771 | 3300032517 | Seawater | LQIGITALGSGWVNPVFVRDDFPEFGTDLVTALSSLNVYDF |
| Ga0314689_101048513 | 3300032518 | Seawater | MIGSGWVNSVFIRNDFPEFGTNLIAALTTLNVNDLAHGGDWKFE |
| Ga0314689_102580691 | 3300032518 | Seawater | VIGSGGVNSVFVRDNFPEFGSDLVTTLSSLDVNDLSHFIVLVCCIFF |
| Ga0314680_109665252 | 3300032521 | Seawater | VIGTGWVNTVFVGDDLPEFSTDLVTALATLDVNDFSHLK |
| Ga0314674_105167531 | 3300032615 | Seawater | VVGTGWVNSVLVGDDLPEFGTDLVSSLTSLDVNDFSHF |
| Ga0314671_105835701 | 3300032616 | Seawater | LEIGITALGSGWVNAVFVRDNFPEFGTDLVTALSSLNVYDF |
| Ga0314683_107610871 | 3300032617 | Seawater | LEIGITALGSGWVNTVFVRDYFPEFGTDLVSALSSLNMYDF |
| Ga0314678_101113971 | 3300032666 | Seawater | VIGSGWVNSVFVRDDFPEFGSDLVTTLSSLYVYDF |
| Ga0314672_13551341 | 3300032709 | Seawater | LQIGITALGSGWVNPVFVRDNFPEFGTDLVTALSSLNVYDF |
| Ga0314686_106421982 | 3300032714 | Seawater | MIGSGWVNSVFIRNDFPEFGTNLIAALTTLDVNDLAHDGDWKFEEG |
| Ga0314698_101807161 | 3300032726 | Seawater | VIGSGGVNTVFIRNYFPEFGTDLVTTLSSLDVYDLSHFFYXLFRLFF |
| Ga0314699_102939291 | 3300032730 | Seawater | VVGSGGVNSVFVGDDFPEFGSDLVTTLSSLDVNDFSHSELIMFFFXIF |
| Ga0314699_104418921 | 3300032730 | Seawater | LEIGITALGSGWVNAVFVRDYFPEFGTDLVTALSSLNVYDF |
| Ga0314714_105703142 | 3300032733 | Seawater | MIGSGWVNSVFIRNDFPEFGSNLVTTLSSLNVYDF |
| Ga0314714_106448161 | 3300032733 | Seawater | LEIGITALSSGWVNTVFVRDYFPEFGTDLVSALSSLNMYD |
| Ga0314701_102590471 | 3300032746 | Seawater | LEIGITALGSGWVNTVFVRDDFPEFGTDLVSALSSLNVYDF |
| Ga0314691_104381901 | 3300032749 | Seawater | LEIGITALGSGWVNAVFVRDNFPEFGTDLVTALSSLNVYDFS |
| Ga0314692_100936261 | 3300032754 | Seawater | VIGSGGVNTVFVRNYFPEFSTNLVTTLSSLDVNDLSHFYLFLML |
| Ga0315742_105262101 | 3300032756 | Forest Soil | MVGSGGINSVFVRNNFPELGSDLVTALAGLDMNDFS |
| Ga0307390_102981501 | 3300033572 | Marine | VIGSGGVNSVFVRDNFPEFGTDLVTTLSSLDMYDFSHLDLSSYFIFKXFFFK |
| ⦗Top⦘ |