| Basic Information | |
|---|---|
| Family ID | F097376 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MKKAVSPKKNKTAADVVPQKKQAKTGPVELDLAELKKVSGGLPRGGWLPK |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.58 % |
| % of genes near scaffold ends (potentially truncated) | 11.54 % |
| % of genes from short scaffolds (< 2000 bps) | 69.23 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.885 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (10.577 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.577 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (46.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.82% β-sheet: 0.00% Coil/Unstructured: 87.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 26.92 |
| PF03472 | Autoind_bind | 20.19 |
| PF13437 | HlyD_3 | 6.73 |
| PF13533 | Biotin_lipoyl_2 | 6.73 |
| PF03412 | Peptidase_C39 | 2.88 |
| PF12698 | ABC2_membrane_3 | 1.92 |
| PF00529 | CusB_dom_1 | 1.92 |
| PF02604 | PhdYeFM_antitox | 0.96 |
| PF08386 | Abhydrolase_4 | 0.96 |
| PF13614 | AAA_31 | 0.96 |
| PF13641 | Glyco_tranf_2_3 | 0.96 |
| PF13318 | AtzG-like | 0.96 |
| PF02954 | HTH_8 | 0.96 |
| PF01810 | LysE | 0.96 |
| PF02798 | GST_N | 0.96 |
| PF12679 | ABC2_membrane_2 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2197 | DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains | Transcription [K] | 40.38 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.96 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.88 % |
| Unclassified | root | N/A | 47.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_109099492 | Not Available | 510 | Open in IMG/M |
| 3300003279|FCL3draft_1000033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 281350 | Open in IMG/M |
| 3300003764|Ga0056910_1000329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 46586 | Open in IMG/M |
| 3300003767|Ga0056908_1014229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 1191 | Open in IMG/M |
| 3300003991|Ga0055461_10009830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1890 | Open in IMG/M |
| 3300004049|Ga0055493_10117657 | Not Available | 583 | Open in IMG/M |
| 3300004155|Ga0066600_10112963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1079 | Open in IMG/M |
| 3300004282|Ga0066599_100056592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 1637 | Open in IMG/M |
| 3300004282|Ga0066599_100576098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Mitsuaria → unclassified Mitsuaria → Mitsuaria sp. H24L5A | 749 | Open in IMG/M |
| 3300005102|Ga0056909_1010882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 2728 | Open in IMG/M |
| 3300005826|Ga0074477_1600776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1473 | Open in IMG/M |
| 3300005940|Ga0073913_10043948 | Not Available | 699 | Open in IMG/M |
| 3300005954|Ga0073925_1044711 | Not Available | 502 | Open in IMG/M |
| 3300006417|Ga0069787_10243688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → unclassified Methylibium → Methylibium sp. T29-B | 6341 | Open in IMG/M |
| 3300006417|Ga0069787_10783358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1067 | Open in IMG/M |
| 3300009009|Ga0105105_10052312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1851 | Open in IMG/M |
| 3300009009|Ga0105105_10223259 | Not Available | 987 | Open in IMG/M |
| 3300009037|Ga0105093_10175848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
| 3300009075|Ga0105090_10003088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 9372 | Open in IMG/M |
| 3300009075|Ga0105090_10018810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4234 | Open in IMG/M |
| 3300009111|Ga0115026_11748392 | Not Available | 525 | Open in IMG/M |
| 3300009131|Ga0115027_10002210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5389 | Open in IMG/M |
| 3300009131|Ga0115027_10195112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1284 | Open in IMG/M |
| 3300009131|Ga0115027_11581496 | Not Available | 541 | Open in IMG/M |
| 3300009168|Ga0105104_10552859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Albitalea → Albitalea terrae | 652 | Open in IMG/M |
| 3300009179|Ga0115028_10342723 | Not Available | 1024 | Open in IMG/M |
| 3300009179|Ga0115028_10501701 | Not Available | 882 | Open in IMG/M |
| 3300009179|Ga0115028_11356289 | Not Available | 595 | Open in IMG/M |
| 3300009455|Ga0114939_10003424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 11114 | Open in IMG/M |
| 3300009527|Ga0114942_1004481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 3855 | Open in IMG/M |
| 3300009527|Ga0114942_1008322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2873 | Open in IMG/M |
| 3300009527|Ga0114942_1108972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 925 | Open in IMG/M |
| 3300009527|Ga0114942_1430329 | Not Available | 534 | Open in IMG/M |
| 3300009654|Ga0116167_1018210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3551 | Open in IMG/M |
| 3300009771|Ga0116155_10081165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1480 | Open in IMG/M |
| 3300009771|Ga0116155_10098810 | Not Available | 1307 | Open in IMG/M |
| 3300009771|Ga0116155_10143517 | Not Available | 1033 | Open in IMG/M |
| 3300009776|Ga0116154_10395877 | Not Available | 590 | Open in IMG/M |
| 3300009781|Ga0116178_10201359 | Not Available | 1015 | Open in IMG/M |
| 3300009838|Ga0116153_10183187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Albitalea → Albitalea terrae | 864 | Open in IMG/M |
| 3300010051|Ga0133939_1001095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 219646 | Open in IMG/M |
| 3300010144|Ga0115593_1321113 | Not Available | 551 | Open in IMG/M |
| 3300010429|Ga0116241_10077365 | Not Available | 2953 | Open in IMG/M |
| 3300010429|Ga0116241_11456756 | Not Available | 511 | Open in IMG/M |
| 3300012020|Ga0119869_1068560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1122 | Open in IMG/M |
| 3300013502|Ga0119901_1111418 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300013833|Ga0119880_1029922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1564 | Open in IMG/M |
| 3300014055|Ga0119878_1024558 | Not Available | 1660 | Open in IMG/M |
| 3300014296|Ga0075344_1047244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Albitalea → Albitalea terrae | 765 | Open in IMG/M |
| 3300014316|Ga0075339_1027424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium | 1377 | Open in IMG/M |
| 3300014316|Ga0075339_1093863 | Not Available | 791 | Open in IMG/M |
| 3300014317|Ga0075343_1100678 | Not Available | 659 | Open in IMG/M |
| 3300014833|Ga0119870_1148832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 689 | Open in IMG/M |
| 3300014833|Ga0119870_1155448 | Not Available | 670 | Open in IMG/M |
| 3300014967|Ga0182827_10024605 | Not Available | 647 | Open in IMG/M |
| 3300019208|Ga0180110_1121778 | Not Available | 554 | Open in IMG/M |
| 3300020064|Ga0180107_1020952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Albitalea → Albitalea terrae | 621 | Open in IMG/M |
| 3300021337|Ga0210341_1339315 | Not Available | 612 | Open in IMG/M |
| (restricted) 3300021517|Ga0224723_1097283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 939 | Open in IMG/M |
| (restricted) 3300021518|Ga0224722_1290039 | Not Available | 520 | Open in IMG/M |
| 3300022396|Ga0210364_1066942 | Not Available | 712 | Open in IMG/M |
| 3300022549|Ga0212091_10003491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4955 | Open in IMG/M |
| 3300022549|Ga0212091_10007371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3493 | Open in IMG/M |
| 3300022549|Ga0212091_10114610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300022549|Ga0212091_10415585 | Not Available | 558 | Open in IMG/M |
| 3300025589|Ga0209409_1019559 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
| 3300025902|Ga0209202_1095900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 963 | Open in IMG/M |
| 3300025958|Ga0210069_1036376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Albitalea → Albitalea terrae | 682 | Open in IMG/M |
| 3300026064|Ga0208146_1008740 | Not Available | 943 | Open in IMG/M |
| 3300026282|Ga0209053_1051573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Albitalea → Albitalea terrae | 705 | Open in IMG/M |
| 3300026282|Ga0209053_1061832 | Not Available | 614 | Open in IMG/M |
| 3300026284|Ga0209792_1077428 | Not Available | 608 | Open in IMG/M |
| 3300026287|Ga0209571_1023933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1085 | Open in IMG/M |
| 3300026289|Ga0209369_1000615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 33922 | Open in IMG/M |
| 3300027547|Ga0209864_1016532 | Not Available | 849 | Open in IMG/M |
| 3300027675|Ga0209077_1133909 | Not Available | 691 | Open in IMG/M |
| 3300027683|Ga0209392_1014719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2441 | Open in IMG/M |
| 3300027683|Ga0209392_1031247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1724 | Open in IMG/M |
| 3300027716|Ga0209682_10168360 | Not Available | 568 | Open in IMG/M |
| 3300027726|Ga0209285_10301778 | Not Available | 505 | Open in IMG/M |
| 3300027841|Ga0209262_10153098 | Not Available | 1105 | Open in IMG/M |
| 3300027871|Ga0209397_10001211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4375 | Open in IMG/M |
| 3300027871|Ga0209397_10181479 | Not Available | 957 | Open in IMG/M |
| 3300027890|Ga0209496_10155869 | Not Available | 1048 | Open in IMG/M |
| 3300027899|Ga0209668_10928012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Albitalea → Albitalea terrae | 587 | Open in IMG/M |
| 3300027900|Ga0209253_10025661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4945 | Open in IMG/M |
| 3300027956|Ga0209820_1137645 | Not Available | 672 | Open in IMG/M |
| 3300031455|Ga0307505_10004352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 8439 | Open in IMG/M |
| 3300031565|Ga0307379_11058595 | Not Available | 686 | Open in IMG/M |
| 3300032144|Ga0315910_10033143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3789 | Open in IMG/M |
| 3300032276|Ga0316188_10075738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1621 | Open in IMG/M |
| 3300033414|Ga0316619_10770129 | Not Available | 819 | Open in IMG/M |
| 3300033418|Ga0316625_100638748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300033419|Ga0316601_100956575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300034159|Ga0370509_0001253 | All Organisms → cellular organisms → Bacteria | 6149 | Open in IMG/M |
| 3300034196|Ga0370503_0014929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2415 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 10.58% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 10.58% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 10.58% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 9.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.69% |
| Wastewater Treatment | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment | 6.73% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 3.85% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.88% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 2.88% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 2.88% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.92% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.92% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.92% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.92% |
| Sewage Treatment Plant | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant | 1.92% |
| Enhanced Biological Phosphorus Removal Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor | 1.92% |
| Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat | 0.96% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.96% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.96% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.96% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.96% |
| Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.96% |
| Activated Sludge | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge | 0.96% |
| Wastewater Treatment | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Unclassified → Wastewater Treatment | 0.96% |
| Down-Flow Hanging Sponge Reactor | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300003279 | Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - U3-798FC-DHS | Engineered | Open in IMG/M |
| 3300003764 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/23/2012_ DNA | Engineered | Open in IMG/M |
| 3300003767 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_10/4/2010_ DNA | Engineered | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005102 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/10/2011_ DNA | Engineered | Open in IMG/M |
| 3300005826 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300005954 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_21-May-14 | Environmental | Open in IMG/M |
| 3300006417 | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 | Engineered | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009654 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG | Engineered | Open in IMG/M |
| 3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
| 3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
| 3300009781 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG | Engineered | Open in IMG/M |
| 3300009838 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG | Engineered | Open in IMG/M |
| 3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
| 3300010144 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300012020 | Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - Activated sludge | Engineered | Open in IMG/M |
| 3300013502 | Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M81612 | Engineered | Open in IMG/M |
| 3300013833 | Sewage treatment plant microbial communities from Vermont, USA - CLO_W | Engineered | Open in IMG/M |
| 3300014055 | Sewage treatment plant microbial communities from Vermont, USA - ANOX_W | Engineered | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014833 | Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - influent sewage | Engineered | Open in IMG/M |
| 3300014967 | Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9Ka | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020064 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021337 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.425 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021517 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR2_MetaG | Environmental | Open in IMG/M |
| 3300021518 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR1_MetaG | Environmental | Open in IMG/M |
| 3300022396 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.633 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022549 | Cold Creek_combined assembly | Environmental | Open in IMG/M |
| 3300025589 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025902 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025958 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026064 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026282 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_7/15/2010_ DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026284 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_6/14/2005_ DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026287 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/10/2011_ DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026289 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_10/4/2010_ DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300034159 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_0210_18 | Environmental | Open in IMG/M |
| 3300034196 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1090994922 | 3300001213 | Wetland | MKKAVSPKKNKTAVDVVPQKKQTKTGPVELDLAELKKVSGGLPRGGWEKVK* |
| FCL3draft_1000033124 | 3300003279 | Down-Flow Hanging Sponge Reactor | MKKAVSPKKNKTANDVVPQKKQVKTGPVELDLAELKKVSGGLPRGGWERMK* |
| Ga0056910_100032914 | 3300003764 | Wastewater Treatment | MKKAVTPKNNKTADDVVTQKKQENKSGPVELNLEELKKVSGGLPKGGWRVK* |
| Ga0056908_10142292 | 3300003767 | Wastewater Treatment | MKKAVTPKKNKTADDVVTQKKQERKTGPVELDLEELKKVSGGLPKGGWKPV* |
| Ga0055461_100098301 | 3300003991 | Natural And Restored Wetlands | MKKAVSPKKSKTAADVVPQKKQTKTGPVELDLADLKKVSGGLPNGTWKQVK* |
| Ga0055493_101176571 | 3300004049 | Natural And Restored Wetlands | MKKAVAPKKIKTAADVVPQKKQTKTGPVELDLADLKKVSGGLPSGTWNQVK* |
| Ga0066600_101129631 | 3300004155 | Freshwater | MKKAVFPKKNKTAADVVPQKKQAKMGPVELDLAELKKVSGGLPRGGWLPK* |
| Ga0066599_1000565922 | 3300004282 | Freshwater | MKKAVSPKKNKTAADVVPQKKQAKTGPVELDLAELKKVSGGLPRGGWLPK* |
| Ga0066599_1005760981 | 3300004282 | Freshwater | MKKAVSPKKNKTAADVVPEKKQAKSGPVELDLAELKKVSGGAPKGGWLPK* |
| Ga0056909_10108823 | 3300005102 | Wastewater Treatment | MKKAVSPKKNKTAADVVPQKKQTKTGPVELDLTELKKVSGGLPRGGWEKIK* |
| Ga0074477_16007762 | 3300005826 | Sediment (Intertidal) | MKKAVSPKKNKTVTDVVPQKKQTKTGPVELDLSDLKKVSGGLPSGTWRIK* |
| Ga0073913_100439482 | 3300005940 | Sand | MKKAVSPKKNKTAADVVTQKKQTPTTGPVELDLSDLKKVSGGTPKGGWARAK* |
| Ga0073925_10447111 | 3300005954 | Sand | MKKAVSPKKNKTAADVVAQKKQAKTGPVELDLAELKKVSGGLPKGGWIK* |
| Ga0069787_102436885 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | MKKAVSPKKNKTATDVVVQKKQAKTGPVELDLAELKKVSGGLPKGGWERMK* |
| Ga0069787_107833582 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | MKKAVTPKKNKTADDVVTQKKQENKSGPVELNLEELKKVSGGLPKGGWRVK* |
| Ga0105105_100523122 | 3300009009 | Freshwater Sediment | MKKAVAPKKNKTATDVVPQKKQAKSGPVELDLAELKKVSGGLPKGGWLLK* |
| Ga0105105_102232591 | 3300009009 | Freshwater Sediment | MKKAVSPKKNKTAADVVPQKKQAKTGPVELDLADLKKVSGGAPKGGWLPK* |
| Ga0105093_101758481 | 3300009037 | Freshwater Sediment | EGVLMKKAVFPKKNKTAADVVPQKKQAKTGPVELDLADLKKVSGGAPKGGWLPK* |
| Ga0105090_100030882 | 3300009075 | Freshwater Sediment | MNKAVEPKKNKTAEDVVSKKKQPSKTGPVELNLDELKKVSGGLPKGGWK* |
| Ga0105090_100188102 | 3300009075 | Freshwater Sediment | MKKAVAPKKNKTATDVVPQKKQAKSSGPVELDLAELKKVSGGLPKGGWLLK* |
| Ga0115026_117483922 | 3300009111 | Wetland | SVPEGVLMKKAVSPKKNKTAADVVPQKKQAKTTGPVELDLADLKKVSGGAPKGGWIPK* |
| Ga0115027_100022102 | 3300009131 | Wetland | MKKAVSPKKNKTAADVVPQKKQAKTGPVELDLAELKKVSGGLPRGGWTKE* |
| Ga0115027_101951122 | 3300009131 | Wetland | MKKAVPAKKNKTAADVVPQKKQAKTGPVELDLSDLKKVSGGAPKGGWLPK* |
| Ga0115027_115814961 | 3300009131 | Wetland | MKKAVSPKKNKTVADVVPQKKQAKSGPVELNLADLKKVSGGLPRGGGGWALK* |
| Ga0105104_105528591 | 3300009168 | Freshwater Sediment | GVLMKKAVSPKKNKTAADVVPQKKQAKTGPVELDLAELKKVSGGLPRGGWLPK* |
| Ga0115028_103427231 | 3300009179 | Wetland | MKKAVPAKKNKTAADVVPQKKQAKTGPVELDLSDLKKVSGGAPKGGWLVK* |
| Ga0115028_105017011 | 3300009179 | Wetland | MKKAVAPKKNKTVADVVPQKKQAKSGPVELNLADLKKVSGGLPRGGGGWALK* |
| Ga0115028_113562892 | 3300009179 | Wetland | MKKAVSPKKNKTAADVVPQKKQAKTTGPVELDLADLKKVSGGAPKGGWIPK* |
| Ga0114939_1000342412 | 3300009455 | Groundwater | MKKAVSTKKTNKTAADVVTQKKQTKSGPVELDLADLKKVAGGLPKGGWDKLR* |
| Ga0114942_10044813 | 3300009527 | Groundwater | MKKAVSPKKNKTAADVVTQKKQAKTTGPVELDLSDLKKVAGGAPKGTWAR* |
| Ga0114942_10083223 | 3300009527 | Groundwater | MKKAVSPKKNKTAADVVPQKKQVKTGPVELDLAELKKVSGGLPRGGWLPK* |
| Ga0114942_11089721 | 3300009527 | Groundwater | MKKAVSSKKNKTATDVVPQKKQTKTGPVELDLAELKKVSGGLPRGGWDKIK* |
| Ga0114942_11426402 | 3300009527 | Groundwater | MKKSVFSKKSQTAADVVTQQKQPKKGPVTLDLAEMKQVSGGLPKGGGWALEKTKPS* |
| Ga0114942_14303291 | 3300009527 | Groundwater | MKKAVSPKKNKTVADVVPQKKQAKSGPVELNLAELKKVSGGLPRGGGGWNVT* |
| Ga0116167_10182102 | 3300009654 | Anaerobic Digestor Sludge | MKKAVSSKKNKTATDVVEQKKQVKTGPVELNLADLKKVSGGLPKGGWERLK* |
| Ga0116155_100811651 | 3300009771 | Anaerobic Digestor Sludge | EPEGVLMKKAVSPKKNKTAADVVPQKKQTKTGPVELDLAELKKVSGGLPKGGWEKIK* |
| Ga0116155_100988101 | 3300009771 | Anaerobic Digestor Sludge | MKKAVSPKKNKTAADVVPQKKQTKTGPVELDLAELKKVSGGLPRGGWEKVK* |
| Ga0116155_101435172 | 3300009771 | Anaerobic Digestor Sludge | MKKAVDPKKNKTANDVVPQKKQTKTGPVELDLAELKKVSGGLPRGGWERAK* |
| Ga0116154_103958772 | 3300009776 | Anaerobic Digestor Sludge | MKKAVSPKKNKTAADVVPQKKQTKTGPVELDLAELKKVSGGLP |
| Ga0116178_102013592 | 3300009781 | Anaerobic Digestor Sludge | MKKAVAPKKKKTAADVVAEKKPAKSGPVVLDLDDLKKVAGGLPKGGWDRK* |
| Ga0116153_101831872 | 3300009838 | Anaerobic Digestor Sludge | MKKAVAPKKNKTAADVVTQKKQAKSGPVELDLADLKKVSGGLPKGGWEKFK* |
| Ga0133939_1001095104 | 3300010051 | Industrial Wastewater | MKKAVAPKKNKTAADVVTQKKQAKSGPVELDLADLKKVAGGLPKGGWEKIK* |
| Ga0115593_13211132 | 3300010144 | Wetland | IAQVETEGVLMKKAVAPKKNKTVADVVPQKKQAKSGPVELNLADLKKVSGGLPRGGGGWALK* |
| Ga0116241_100773652 | 3300010429 | Anaerobic Digestor Sludge | MKKAVSPKKNKTAADVVPQKKQTKTGPVELDLAELKKVSGGLPKGGWEKIK* |
| Ga0116241_114567561 | 3300010429 | Anaerobic Digestor Sludge | MKKAVAPKKNKTAADVVTQKKQVKSGPIELDLADLKKVSGGLPKGGWGKLK* |
| Ga0119869_10685602 | 3300012020 | Activated Sludge | MKKAVSPKKNKTATDVVVQKKQAKSGPVELDLADLKKVSGGLPKGGWSPAK* |
| Ga0119901_11114182 | 3300013502 | Activated Sludge | MKKAVASKKNKTATDVVPQKKQTKTGPVELDLAELKKVSGGLPKGGWERTK* |
| Ga0119880_10299221 | 3300013833 | Sewage Treatment Plant | MKKAVSPKKNKTAADVVPQEKKQTKTGPVELDLADLKKVSGGLPNGTWNRVK* |
| Ga0119878_10245582 | 3300014055 | Sewage Treatment Plant | MKKAVSPKKNKTAADGVPQEKKQTKTGPVELDLADLKKVSGGLPNGTWNRVK* |
| Ga0075344_10472441 | 3300014296 | Natural And Restored Wetlands | MKKAVSPKKTKTAADVVPQKKQTKTGPVELDLADLKKVSGGLPNGTWKQVR* |
| Ga0075339_10274241 | 3300014316 | Natural And Restored Wetlands | MKKAVAPKKSKTAADVVRQKKQVKSGPVELDLSEMKKVSGGLPFGTWKEVK* |
| Ga0075339_10938632 | 3300014316 | Natural And Restored Wetlands | MKKAVTPKKNKTAADVVSQKKQTKSGPVELDLTDLKKVSGGLPKGGWAQVKQS* |
| Ga0075343_11006781 | 3300014317 | Natural And Restored Wetlands | MKKAVAPKKNKTAADVVPQKKQAKGGPVELDLAELKKVSGGLPSGTWRPIK* |
| Ga0119870_11488321 | 3300014833 | Activated Sludge | VSPKKNKTATDVVVQKKQAKTGPVELDLAELKKVSGGLPKGGWERMK* |
| Ga0119870_11554481 | 3300014833 | Activated Sludge | MKKAVSPKKNKTASDVVEQKKQAKSGPVELDLADLKKVSGGLPKGGWSPAK* |
| Ga0182827_100246052 | 3300014967 | Microbial Mat | MKKAVAPKKSKTAADVVSQKKQAKSGPVELDLAELKKVSGGLPRGGGWVAAK* |
| Ga0184628_101822602 | 3300018083 | Groundwater Sediment | MKKSVFSKKSTTASDVVTQQKQPKKGPVALDLADMKQVSGGLPRGGGWALDKTKQS |
| Ga0190270_120545511 | 3300018469 | Soil | MKKSVFSKKSTAAADVVTQPKQPKKGPVALDLADMKQVSGGLPRGGGWALDKAKQS |
| Ga0190274_100902854 | 3300018476 | Soil | MKKSVFSKKSTTAADVVTQPKQPKKGPVALDLADMKQVSGGLPRGGGW |
| Ga0190271_100618432 | 3300018481 | Soil | MKKSVFSKKSTTAADVVTQPKQPKKGPVALDLADMKQVSGGLPKGQWAALDKIKQS |
| Ga0190271_101626531 | 3300018481 | Soil | MKKSVFSKKSTSAADVVTQQKQPKKGPVALDLADMKQVSGGLPKGGGWALEKTKPS |
| Ga0190271_102225722 | 3300018481 | Soil | MKKSVFSKKSTTAADVVTQQKQPKKGPVALDLADLKQVSGGAPRSTWALDKTKQS |
| Ga0180110_11217781 | 3300019208 | Groundwater Sediment | MKKAVSPKKNKTVADVVPQKKQAKSGPVELNLADLKKVSGGLPRGGGGWNVK |
| Ga0180107_10209521 | 3300020064 | Groundwater Sediment | MKKAVSPKKSKTVADVVPQKKQAKSGPVELNLADLKKVSGGLPRGGGGWNVK |
| Ga0210341_13393152 | 3300021337 | Estuarine | MKKAVSPKKSKTAADVVPQKKQTKTGPVELDLADLKKVSGGLPNGTWKQVR |
| (restricted) Ga0224723_10972832 | 3300021517 | Freshwater Sediment | MKKAVAPKKNKTAKDVVPQNKQTKTTGPVELDLDTLKKVSGGLPRGGWIREK |
| (restricted) Ga0224722_12900391 | 3300021518 | Freshwater Sediment | MKKAVAPKKNKTAKDVVPQDKQTKAGPVELDLETLKKVSGGLPRGGWIREK |
| Ga0210364_10669422 | 3300022396 | Estuarine | MKKAVSPKKSKTAADVVPQKKQTKTGPVELDLADLKKVSGGLPNGTWKQVK |
| Ga0212091_100034915 | 3300022549 | Groundwater | MKKAVSPKKNKTAADVVPQKKQAKTGPVELDLSDLKKVSGGAPKGGWNTIR |
| Ga0212091_100073713 | 3300022549 | Groundwater | MKKAVSPKKNKTAADVVTQKKQAKTTGPVELDLSDLKKVAGGAPKGTWAR |
| Ga0212091_101146101 | 3300022549 | Groundwater | MKKAVSSKKNKTATDVVPQKKQTKTGPVELDLAELKKVSGGLPRGGWDKIK |
| Ga0212091_104155851 | 3300022549 | Groundwater | MKKAVSPKKNKTVADVVPQKKQARSGPVELDLVDLKKVSGGLPHGKWTSIK |
| Ga0209409_10195592 | 3300025589 | Anaerobic Digestor Sludge | MKKAVSSKKNKTATDVVEQKKQVKTGPVELNLADLKKVSGGLPKGGWERLK |
| Ga0209202_10959002 | 3300025902 | Anaerobic Digestor Sludge | MKKAVSPKKNKTAADVVPQKKQTKTGPVELDLAELKKVSGGLPRGGWEKVK |
| Ga0210069_10363761 | 3300025958 | Natural And Restored Wetlands | ESEGVLMKKAVAPKKSKTAADVVRQKKQVKSGPVELDLSEMKKVSGGLPFGTWKEIK |
| Ga0208146_10087401 | 3300026064 | Natural And Restored Wetlands | MKKAVSPKKNKTATDVVPQKKQTKTGPVELDLAELKKVSGGLPKGGWER |
| Ga0209053_10515732 | 3300026282 | Wastewater Treatment | MKKAVSPKKNKTATDVVPQKKQTKTGPVELDLTELKKVSGGLPRGGWEKIK |
| Ga0209053_10618321 | 3300026282 | Wastewater Treatment | MKKAVTPKNNKTADDVVTQKKQENKSGPVELNLEELKKVSGGLPKGGWRVK |
| Ga0209792_10774282 | 3300026284 | Wastewater Treatment | MKKAVAPKKKKTAADVVAEKKPAKSGPVVLDLDDLKKVAGGLPKGGWDRK |
| Ga0209571_10239332 | 3300026287 | Wastewater Treatment | MKKAVSPKKNKTAADVVPQKKQTKTGPVELDLTELKKVSGGLPRGGWEKIK |
| Ga0209369_100061528 | 3300026289 | Wastewater Treatment | MKKAVTPKKNKTADDVVTQKKQERKTGPVELDLEELKKVSGGLPKGGWKPV |
| Ga0209864_10165322 | 3300027547 | Sand | MKKAVSPKKNKTAADVVTQKKQTPTTGPVELDLSDLKKVSGGTPKGGWARAK |
| Ga0209077_11339091 | 3300027675 | Freshwater Sediment | MKKAVSPKKNKTAADVVPQKKQAKTGPVELDLAELKKVSGGLPRGGWLPK |
| Ga0209392_10147192 | 3300027683 | Freshwater Sediment | MKKAVAPKKNKTATDVVPQKKQAKSGPVELDLAELKKVSGGLPKGGWLLK |
| Ga0209392_10312473 | 3300027683 | Freshwater Sediment | MNKAVEPKKNKTAEDVVSKKKQPSKTGPVELNLDELKKVSGGLPKGGWK |
| Ga0209682_101683602 | 3300027716 | Wetland Sediment | MKKAVSPKKNKTAADVVPQKKQAKSGPVELDLAELKKVSGGLPRGGWALK |
| Ga0209285_103017782 | 3300027726 | Freshwater Sediment | MKKAVAPKKNKTATDVVPQKKQAKSGPVELDLAELKKVSGGLPKG |
| Ga0209262_101530982 | 3300027841 | Freshwater | MKKAVFPKKNKTAADVVPQKKQAKMGPVELDLAELKKVSGGLPRGGWLPK |
| Ga0209397_100012113 | 3300027871 | Wetland | MKKAVSPKKNKTAADVVPQKKQAKTGPVELDLAELKKVSGGLPRGGWTKE |
| Ga0209397_101814791 | 3300027871 | Wetland | MKKAVPAKKNKTAADVVPQKKQAKTGPVELDLSDLKKVSGGAPKGGWLPK |
| Ga0209496_101558692 | 3300027890 | Wetland | MKKAVPAKKNKTAADVVPQKKQAKTGPVELDLSDLKKVSGGAPKGGWLVK |
| Ga0209668_109280122 | 3300027899 | Freshwater Lake Sediment | MKKAVSPKKNKTAADVVPQKKQAKTTGPVELDLADLKKVSGGAPKGGWLPK |
| Ga0209253_100256614 | 3300027900 | Freshwater Lake Sediment | MKKAVSPKKKNKTAADVVPEKKQAKSGPVELDLAELKKVSGGAPKGGWIPK |
| Ga0209820_11376452 | 3300027956 | Freshwater Sediment | MKKAVSPKKNKTAADVVPQKKQAKTGPVELDLSDLKKVSGGAPKGGWLPK |
| Ga0307505_100043524 | 3300031455 | Soil | MKKAVSPKKNKTATDVVPQKKQTKTGPVELDLAELKKVSGGLPKGGWERLK |
| Ga0307379_110585952 | 3300031565 | Soil | MKKAVSPKKNKTVTDVVPQKKQTKTGPVELDLSDLKKVSGGLPSGTWRTK |
| Ga0315910_100331434 | 3300032144 | Soil | MKKAVSPKKNKTATDVVPQKKQTKTGPVELDLADLKKVSGGLPKGGWEKIK |
| Ga0315912_112709361 | 3300032157 | Soil | MKKSVFSKRSTTAPDVVTQPKQPKKGPVALDLADLKQVSGGLPKGSWAALDKVKQS |
| Ga0316188_100757381 | 3300032276 | Worm Burrow | MKKAVTPKKNKTAADVVPQKKQTKTGPVELDLADLKKVSGGLPSGTWKQIK |
| Ga0316619_107701292 | 3300033414 | Soil | MKKAVSPKKNKTAADVVPQKKQAKTTGPVELDLADLKKVSGGAPKGGWIPK |
| Ga0316625_1006387481 | 3300033418 | Soil | MKKAVSPKKNKTVADVVPQKKQAKSGPVELNLADLKKVSGGLPRGGGGWALK |
| Ga0316601_1009565751 | 3300033419 | Soil | RSVPEGVLMKKAVSPKKNKTAADVVPQKKQAKTTGPVELDLADLKKVSGGAPKGGWIPK |
| Ga0370509_0001253_5758_5910 | 3300034159 | Untreated Peat Soil | MKKAVSPKKNKTAADVVPQKKQTKTGPVELDLAELKKVSGGLPKGGWVRQ |
| Ga0370503_0014929_2264_2413 | 3300034196 | Untreated Peat Soil | KKAVSPKKNKTAADVVPQKKQTKTGPVELDLAELKKVSGGLPKGGWVRQ |
| ⦗Top⦘ |