| Basic Information | |
|---|---|
| Family ID | F065766 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MADEKKDEGAGDPIKILLEEALERQRNAMMDSFAQILQ |
| Number of Associated Samples | 56 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.60 % |
| % of genes near scaffold ends (potentially truncated) | 34.65 % |
| % of genes from short scaffolds (< 2000 bps) | 71.65 % |
| Associated GOLD sequencing projects | 55 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.055 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room (33.071 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.339 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Surface (non-saline) (33.858 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.88% β-sheet: 0.00% Coil/Unstructured: 62.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF03732 | Retrotrans_gag | 3.97 |
| PF00078 | RVT_1 | 3.17 |
| PF13650 | Asp_protease_2 | 2.38 |
| PF07727 | RVT_2 | 2.38 |
| PF14223 | Retrotran_gag_2 | 1.59 |
| PF00665 | rve | 0.79 |
| PF00385 | Chromo | 0.79 |
| PF00271 | Helicase_C | 0.79 |
| PF00098 | zf-CCHC | 0.79 |
| PF02160 | Peptidase_A3 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.79 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.79 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.79 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.06 % |
| All Organisms | root | All Organisms | 40.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005661|Ga0058698_10638104 | Not Available | 663 | Open in IMG/M |
| 3300006491|Ga0100376_10301 | Not Available | 795 | Open in IMG/M |
| 3300008093|Ga0100393_10530302 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 523 | Open in IMG/M |
| 3300009089|Ga0099828_11505865 | Not Available | 593 | Open in IMG/M |
| 3300009144|Ga0058702_10483573 | Not Available | 516 | Open in IMG/M |
| 3300009853|Ga0118741_1001740 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 1115 | Open in IMG/M |
| 3300009853|Ga0118741_1012469 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 664 | Open in IMG/M |
| 3300009853|Ga0118741_1031771 | Not Available | 523 | Open in IMG/M |
| 3300009853|Ga0118741_1033213 | Not Available | 516 | Open in IMG/M |
| 3300010395|Ga0058701_10793343 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Rosoideae → Potentilleae → Fragariinae → Fragaria → Fragaria vesca → Fragaria vesca subsp. vesca | 517 | Open in IMG/M |
| 3300011271|Ga0137393_11571761 | Not Available | 547 | Open in IMG/M |
| 3300012056|Ga0153925_1013290 | Not Available | 887 | Open in IMG/M |
| 3300012062|Ga0153992_108880 | Not Available | 1171 | Open in IMG/M |
| 3300012073|Ga0153979_1061814 | Not Available | 718 | Open in IMG/M |
| 3300012073|Ga0153979_1085561 | Not Available | 558 | Open in IMG/M |
| 3300012076|Ga0153971_1046009 | Not Available | 791 | Open in IMG/M |
| 3300012076|Ga0153971_1095520 | Not Available | 507 | Open in IMG/M |
| 3300012076|Ga0153971_1097380 | Not Available | 502 | Open in IMG/M |
| 3300012084|Ga0153934_1025592 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 794 | Open in IMG/M |
| 3300012084|Ga0153934_1042584 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 671 | Open in IMG/M |
| 3300012084|Ga0153934_1080201 | Not Available | 564 | Open in IMG/M |
| 3300012084|Ga0153934_1098804 | Not Available | 533 | Open in IMG/M |
| 3300012084|Ga0153934_1117055 | Not Available | 509 | Open in IMG/M |
| 3300012084|Ga0153934_1120342 | Not Available | 505 | Open in IMG/M |
| 3300012089|Ga0153924_1053850 | Not Available | 786 | Open in IMG/M |
| 3300012609|Ga0120836_104583 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 513 | Open in IMG/M |
| 3300013860|Ga0181456_101741 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1307 | Open in IMG/M |
| 3300013862|Ga0181459_103866 | Not Available | 1488 | Open in IMG/M |
| 3300013864|Ga0181472_100236 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 7936 | Open in IMG/M |
| 3300013864|Ga0181472_101006 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 5568 | Open in IMG/M |
| 3300013864|Ga0181472_104635 | Not Available | 2560 | Open in IMG/M |
| 3300013864|Ga0181472_117061 | Not Available | 548 | Open in IMG/M |
| 3300013866|Ga0181473_101402 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica | 6901 | Open in IMG/M |
| 3300013866|Ga0181473_102932 | Not Available | 4765 | Open in IMG/M |
| 3300013866|Ga0181473_105371 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 2810 | Open in IMG/M |
| 3300013867|Ga0181467_116452 | Not Available | 668 | Open in IMG/M |
| 3300013868|Ga0181469_100627 | Not Available | 13454 | Open in IMG/M |
| 3300013868|Ga0181469_100866 | Not Available | 11560 | Open in IMG/M |
| 3300013868|Ga0181469_100914 | All Organisms → cellular organisms → Eukaryota | 11208 | Open in IMG/M |
| 3300013868|Ga0181469_100977 | Not Available | 10866 | Open in IMG/M |
| 3300013868|Ga0181469_103144 | Not Available | 4967 | Open in IMG/M |
| 3300013868|Ga0181469_124875 | Not Available | 520 | Open in IMG/M |
| 3300013869|Ga0181468_100728 | Not Available | 6734 | Open in IMG/M |
| 3300013870|Ga0181465_100381 | Not Available | 17157 | Open in IMG/M |
| 3300013870|Ga0181465_100756 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 13660 | Open in IMG/M |
| 3300013870|Ga0181465_100898 | All Organisms → cellular organisms → Eukaryota | 12737 | Open in IMG/M |
| 3300013870|Ga0181465_101076 | Not Available | 11758 | Open in IMG/M |
| 3300013870|Ga0181465_101174 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 11289 | Open in IMG/M |
| 3300013870|Ga0181465_101458 | Not Available | 9985 | Open in IMG/M |
| 3300013870|Ga0181465_102758 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota → Peronosporales → Peronosporaceae → Phytophthora | 6273 | Open in IMG/M |
| 3300013870|Ga0181465_103520 | Not Available | 4955 | Open in IMG/M |
| 3300013870|Ga0181465_103520 | Not Available | 4955 | Open in IMG/M |
| 3300013871|Ga0181466_1000229 | Not Available | 20393 | Open in IMG/M |
| 3300013872|Ga0181463_1000021 | All Organisms → cellular organisms → Bacteria | 24699 | Open in IMG/M |
| 3300013872|Ga0181463_1001521 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 6649 | Open in IMG/M |
| 3300013872|Ga0181463_1009737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. ATUFL_F1_KS39 | 1583 | Open in IMG/M |
| 3300013872|Ga0181463_1036337 | Not Available | 580 | Open in IMG/M |
| 3300013873|Ga0181464_1000159 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 22774 | Open in IMG/M |
| 3300013873|Ga0181464_1000877 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 14274 | Open in IMG/M |
| 3300013873|Ga0181464_1002158 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 9875 | Open in IMG/M |
| 3300013873|Ga0181464_1002247 | Not Available | 9655 | Open in IMG/M |
| 3300013873|Ga0181464_1004497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. ATUFL_F1_KS39 | 6150 | Open in IMG/M |
| 3300013873|Ga0181464_1008974 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri | 3313 | Open in IMG/M |
| 3300013873|Ga0181464_1029967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. ATUFL_F1_KS39 | 1045 | Open in IMG/M |
| 3300013873|Ga0181464_1031700 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 994 | Open in IMG/M |
| 3300013873|Ga0181464_1053747 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 642 | Open in IMG/M |
| 3300013873|Ga0181464_1059270 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 594 | Open in IMG/M |
| 3300014120|Ga0181451_10482 | Not Available | 1660 | Open in IMG/M |
| 3300014228|Ga0135143_10027 | Not Available | 683 | Open in IMG/M |
| 3300014243|Ga0135126_10131 | Not Available | 779 | Open in IMG/M |
| 3300015291|Ga0182125_1001087 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1760 | Open in IMG/M |
| 3300015294|Ga0182126_1007443 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 1034 | Open in IMG/M |
| 3300015316|Ga0182121_1046878 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 782 | Open in IMG/M |
| 3300015316|Ga0182121_1132119 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 524 | Open in IMG/M |
| 3300015321|Ga0182127_1047415 | Not Available | 680 | Open in IMG/M |
| 3300015324|Ga0182134_1011003 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 1203 | Open in IMG/M |
| 3300019378|Ga0187901_10818871 | Not Available | 697 | Open in IMG/M |
| 3300020586|Ga0213497_1000230 | All Organisms → cellular organisms → Eukaryota | 4954 | Open in IMG/M |
| 3300020586|Ga0213497_1023158 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 708 | Open in IMG/M |
| 3300020586|Ga0213497_1052485 | Not Available | 547 | Open in IMG/M |
| 3300020586|Ga0213497_1058262 | Not Available | 530 | Open in IMG/M |
| 3300020586|Ga0213497_1064414 | Not Available | 514 | Open in IMG/M |
| 3300020588|Ga0213495_10003313 | Not Available | 1543 | Open in IMG/M |
| 3300020588|Ga0213495_10012451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. ATUFL_F1_KS39 | 957 | Open in IMG/M |
| 3300020588|Ga0213495_10084853 | Not Available | 533 | Open in IMG/M |
| 3300020588|Ga0213495_10089817 | Not Available | 525 | Open in IMG/M |
| 3300020590|Ga0213496_10000159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. ATUFL_F1_KS39 | 6202 | Open in IMG/M |
| 3300020590|Ga0213496_10005321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. ATUFL_F1_KS39 | 1261 | Open in IMG/M |
| 3300020590|Ga0213496_10007863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. ATUFL_F1_KS39 | 1089 | Open in IMG/M |
| 3300020590|Ga0213496_10011779 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 945 | Open in IMG/M |
| 3300020590|Ga0213496_10072491 | Not Available | 537 | Open in IMG/M |
| 3300020600|Ga0213498_10020518 | Not Available | 863 | Open in IMG/M |
| 3300020600|Ga0213498_10022989 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300020600|Ga0213498_10024953 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 812 | Open in IMG/M |
| 3300020600|Ga0213498_10056146 | Not Available | 639 | Open in IMG/M |
| 3300020600|Ga0213498_10058057 | Not Available | 633 | Open in IMG/M |
| 3300020600|Ga0213498_10107656 | Not Available | 532 | Open in IMG/M |
| 3300020602|Ga0213500_10031090 | Not Available | 876 | Open in IMG/M |
| 3300020602|Ga0213500_10049766 | Not Available | 765 | Open in IMG/M |
| 3300020602|Ga0213500_10052038 | Not Available | 755 | Open in IMG/M |
| 3300020816|Ga0214090_10156892 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 552 | Open in IMG/M |
| 3300023016|Ga0233333_1000364 | Not Available | 2699 | Open in IMG/M |
| 3300023036|Ga0233330_1030040 | Not Available | 505 | Open in IMG/M |
| 3300023043|Ga0233346_1000431 | Not Available | 2702 | Open in IMG/M |
| 3300023224|Ga0224575_109212 | Not Available | 543 | Open in IMG/M |
| 3300023280|Ga0255813_11863044 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 600 | Open in IMG/M |
| 3300023291|Ga0256703_10682610 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 601 | Open in IMG/M |
| 3300026557|Ga0179587_10363658 | Not Available | 940 | Open in IMG/M |
| 3300031474|Ga0170818_111023978 | Not Available | 669 | Open in IMG/M |
| 3300031708|Ga0310686_100747811 | Not Available | 763 | Open in IMG/M |
| 3300031708|Ga0310686_108775630 | Not Available | 617 | Open in IMG/M |
| 3300031708|Ga0310686_109008480 | Not Available | 527 | Open in IMG/M |
| 3300031708|Ga0310686_111664259 | Not Available | 1653 | Open in IMG/M |
| 3300031708|Ga0310686_113151179 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 574 | Open in IMG/M |
| 3300031708|Ga0310686_117811983 | Not Available | 512 | Open in IMG/M |
| 3300031708|Ga0310686_118048638 | Not Available | 503 | Open in IMG/M |
| 3300031708|Ga0310686_118756898 | Not Available | 545 | Open in IMG/M |
| 3300032159|Ga0268251_10228455 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 742 | Open in IMG/M |
| 3300032468|Ga0214482_1090758 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 580 | Open in IMG/M |
| 3300032515|Ga0348332_10540808 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1677 | Open in IMG/M |
| 3300032551|Ga0321339_1133067 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 553 | Open in IMG/M |
| 3300032551|Ga0321339_1154680 | Not Available | 502 | Open in IMG/M |
| 3300033544|Ga0316215_1006310 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis | 1149 | Open in IMG/M |
| 3300033548|Ga0316216_1020556 | Not Available | 548 | Open in IMG/M |
| 3300033548|Ga0316216_1022841 | Not Available | 525 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Clean Room | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room | 33.07% |
| Leaf | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf | 18.11% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 11.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.30% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 4.72% |
| Wood Falls | Environmental → Aquatic → Marine → Oceanic → Benthic → Wood Falls | 3.15% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 3.15% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 3.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.36% |
| Leaf Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter | 2.36% |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 2.36% |
| Food Waste | Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste | 2.36% |
| Indoor Hospital Air | Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air | 1.57% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.79% |
| Human | Host-Associated → Human → Respiratory System → Nasopharyngeal → Anterior Nares → Human | 0.79% |
| Goat Feces | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces | 0.79% |
| Clean Room | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Clean Room | 0.79% |
| City Subway Metal | Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005661 | Agave microbial communities from Guanajuato, Mexico - As.Sf.e | Host-Associated | Open in IMG/M |
| 3300006491 | Human anterior nares microbial communities from NIH, USA - visit 1, subject 763901136 | Host-Associated | Open in IMG/M |
| 3300008093 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-17 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009144 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.e | Host-Associated | Open in IMG/M |
| 3300009853 | Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - F3EC | Environmental | Open in IMG/M |
| 3300010395 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012056 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ009 MetaG | Host-Associated | Open in IMG/M |
| 3300012062 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC076 MetaG | Host-Associated | Open in IMG/M |
| 3300012073 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA063 MetaG | Host-Associated | Open in IMG/M |
| 3300012076 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA055 MetaG | Host-Associated | Open in IMG/M |
| 3300012084 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ018 MetaG | Host-Associated | Open in IMG/M |
| 3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
| 3300012609 | Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00357 | Engineered | Open in IMG/M |
| 3300013860 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In3 SAF170 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013862 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In2P SAF170 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013864 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - In1P-11 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013866 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - In2P-11 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013867 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In5-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013868 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In2 SAF170 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013869 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In1 SAF170 SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013870 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In3-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013871 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In4-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013872 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In1-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013873 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In2-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300014120 | Clean room spacecraft assembly facility microbial communities from NASA Jet Propulsion Laboratory, California, USA - Floor swab, replicate C SPAdes reassembly | Engineered | Open in IMG/M |
| 3300014228 | Indoor hospital air microbial communities from San Diego, USA - 211_L1_2014-6-9 | Environmental | Open in IMG/M |
| 3300014243 | Indoor hospital air microbial communities from San Diego, USA - 174_L1_2014-4-30 | Environmental | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300019378 | Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Alfalfa, Gen0, Rep 2, Chloramphenicol | Host-Associated | Open in IMG/M |
| 3300020586 | Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_3 | Host-Associated | Open in IMG/M |
| 3300020588 | Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_1 | Host-Associated | Open in IMG/M |
| 3300020590 | Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_2 | Host-Associated | Open in IMG/M |
| 3300020600 | Leaf-associated microbial communities from Pinus contorta in Yosemite National Park, California, United States - Lodgepole_Yose_4 | Host-Associated | Open in IMG/M |
| 3300020602 | Leaf-associated microbial communities from Abies magnifica in Yosemite National Park, California, United States - Redfir_Yose_2 | Host-Associated | Open in IMG/M |
| 3300020816 | Food waste microbial community from Durham, Ontario, Canada - FW1 megahit | Engineered | Open in IMG/M |
| 3300023016 | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-213 | Environmental | Open in IMG/M |
| 3300023036 | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-201 | Environmental | Open in IMG/M |
| 3300023043 | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-289 | Environmental | Open in IMG/M |
| 3300023224 | Spruce roots microbial communities from Bohemian Forest, Czech Republic ? CRU4 | Host-Associated | Open in IMG/M |
| 3300023280 | Combined Assembly of Gp0238881, Gp0242115 | Engineered | Open in IMG/M |
| 3300023291 | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada. Combined Assembly of Gp0242115, Gp0242119 | Engineered | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032468 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Host-Associated | Open in IMG/M |
| 3300033548 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0058698_106381041 | 3300005661 | Agave | MGEEKKDEGAGYPIKILLEEALEKKRNAMMDNFAQILQRLPTGG |
| Ga0100376_103011 | 3300006491 | Human | MADEKKDEGAGDPIKILLEEALERQRNTMMDNFA* |
| Ga0100393_105303021 | 3300008093 | Aquifer | MGDEKKDERVGDPIKIFLEEALEKQSNTIMDNFSQTLQ* |
| Ga0099828_115058651 | 3300009089 | Vadose Zone Soil | MRDEKKDEGTEDPIKMLLEEALEKQRNVMMDNFAQILQRLPT |
| Ga0058702_104835732 | 3300009144 | Agave | MGDEKRDEGAGDTIKILLEEALEKQRNAMMDNFAQILQ* |
| Ga0118741_10017401 | 3300009853 | Wood Falls | MADEKKYEGAGDPIKILLEEALERQRNAMMDSFAQILQ |
| Ga0118741_10124692 | 3300009853 | Wood Falls | MADEKKDEGVGDLIKIFLEEALERKRNTMTDNFS* |
| Ga0118741_10317711 | 3300009853 | Wood Falls | MVDEKKDKGAGDSIKILIEEALEKQRNAMMDSFA* |
| Ga0118741_10332131 | 3300009853 | Wood Falls | MAEEKKDEGVGDPIKILLKETLEWKRNVMMDSFAQILQQLPKGDA* |
| Ga0058701_107933431 | 3300010395 | Agave | MPMGDEKKDEGVGDPIKILLEEALEKQRNAMMDKFSKILQ* |
| Ga0137393_115717611 | 3300011271 | Vadose Zone Soil | MAEEKRDDGAGDPINSLLEEALDRQRNEMMDSFAQILR* |
| Ga0153925_10132901 | 3300012056 | Attine Ant Fungus Gardens | MAHEKKDEGAGDPIKILLEEALERQRNAMMDSFAQILQRL |
| Ga0153992_1088802 | 3300012062 | Attine Ant Fungus Gardens | MADEKKDEGAGDPIKILLEEVLERQRNAMMDNFAQIL* |
| Ga0153979_10618141 | 3300012073 | Attine Ant Fungus Gardens | MADEKKDEGAGDPIKILLEEALERQRNAMMDIFA* |
| Ga0153979_10855611 | 3300012073 | Attine Ant Fungus Gardens | MADEKKDEGAGDPIKILLEEALERQQNAMMDSFAQILQRLPG |
| Ga0153971_10460093 | 3300012076 | Attine Ant Fungus Gardens | MAEEKKDEGAGGPLKMLPEDSLERYRDAMMDKFAQFL* |
| Ga0153971_10955202 | 3300012076 | Attine Ant Fungus Gardens | ANEKKDEGVGDPIKILLDEALERQRNMMMDNFAQILQ* |
| Ga0153971_10973802 | 3300012076 | Attine Ant Fungus Gardens | MLDEKKDEGAGDPIKIFLEEALEQQRNAMMDNFAQIL* |
| Ga0153934_10255922 | 3300012084 | Attine Ant Fungus Gardens | MASMADEKKGKGARDPIKILLKNALKQQMNAMMENFA* |
| Ga0153934_10425842 | 3300012084 | Attine Ant Fungus Gardens | MVDEKKDEGTGDPIKILLEEALEQQRNVMMDKFSQIL* |
| Ga0153934_10802012 | 3300012084 | Attine Ant Fungus Gardens | MGEENKDEGVGDPIKMLLEEAFEKQRNEMMDNFA* |
| Ga0153934_10988042 | 3300012084 | Attine Ant Fungus Gardens | MADEKKDEGAGDPIKILLEEALEQQRNAMMDNFS* |
| Ga0153934_11129171 | 3300012084 | Attine Ant Fungus Gardens | MAEENKDEGVGDPFKTLLEEALRRQRNTMMDIFSHILS* |
| Ga0153934_11170551 | 3300012084 | Attine Ant Fungus Gardens | MASMADEKKDDGARDPIKILLEEALKRQRNVMMDNFS* |
| Ga0153934_11203422 | 3300012084 | Attine Ant Fungus Gardens | MGGEKKGDGVGDPIKILLEEALERQRNTMMDNFAQILQ* |
| Ga0153924_10538502 | 3300012089 | Attine Ant Fungus Gardens | MADEKKDEGVGDPIKILLDEALEQQRNAMMDSFA* |
| Ga0120836_1045831 | 3300012609 | City Subway Metal | MGDEKKDEGAGDPMKILLEEALEKQRNTVMDKFAQILQ* |
| Ga0181456_1017412 | 3300013860 | Clean Room | MGKEKKGEGVGDPIKILFKEALEKQRNAMMEKNS* |
| Ga0181459_1038662 | 3300013862 | Clean Room | MADENKDKGARDPIKILLEEALEQQRNVMMDNFSHIL* |
| Ga0181472_1002364 | 3300013864 | Clean Room | MTDENKDEWAGDPTKILLEEVLEWQRNAMMDNFA* |
| Ga0181472_1010063 | 3300013864 | Clean Room | MGEENKDKGAGDPIKILLEDALEKQMNAMMDKFS* |
| Ga0181472_1046352 | 3300013864 | Clean Room | MVDENKDEGAGDPNKIFLKESLKRQRNAMMEKFA* |
| Ga0181472_1170612 | 3300013864 | Clean Room | MADEKKDEGAGDPIRILLEEALERQRNAMMDSFAQILQ |
| Ga0181473_1014022 | 3300013866 | Clean Room | MADEKKDEGEGDPNKILLEEAIERQRNAMMDNFSHILR* |
| Ga0181473_1029321 | 3300013866 | Clean Room | MGEEKKDEGTGYPIKIFLEEALEKQRNVMINNFS* |
| Ga0181473_1053711 | 3300013866 | Clean Room | MADEKKDEGARDPIKILLKEALEQQRNAMMDNFS* |
| Ga0181473_1066973 | 3300013866 | Clean Room | MAEENKDEGVRDFFKILPEEALERQRNVMMENFSQIFIWQPL* |
| Ga0181467_1164521 | 3300013867 | Clean Room | MADEKKDEGAGDPIKILLKEALEWQRNAMMDSFA* |
| Ga0181469_10062714 | 3300013868 | Clean Room | QMKRKTRGAGDPIKILLEEALERQRNTMMESFSQIL* |
| Ga0181469_1008667 | 3300013868 | Clean Room | MADEKKDKGAGDPIKILLEEALERQQNAMMDNFA* |
| Ga0181469_1009145 | 3300013868 | Clean Room | MGEEKKDEGVGDPIKILLNEALEKQRNAMMDKFF* |
| Ga0181469_1009774 | 3300013868 | Clean Room | MVEEKNDEGVGDPFKMMLEEALKRQRDAMMNKFG* |
| Ga0181469_1031445 | 3300013868 | Clean Room | MVEEKKDEGAGDHIKIFLNEALERQRNAMMDKFAQIL* |
| Ga0181469_1248751 | 3300013868 | Clean Room | MAEENKDEGVGYPFKIFLEEALKRQRNAMMDNFA* |
| Ga0181468_1007286 | 3300013869 | Clean Room | MADEKKDEVGGDPIKILLEEALERQWNVMMDSFAQIL* |
| Ga0181465_1003818 | 3300013870 | Clean Room | MAKENKDKGSGDPFKMLFKEALEKQRDMMMDNFSQIL* |
| Ga0181465_1007569 | 3300013870 | Clean Room | MADEKKDEGAGDPIRILLEEALERQRNAMMDSFA* |
| Ga0181465_1008988 | 3300013870 | Clean Room | MGEEKKDEGGGYPIKILLEEALKKQRKVMMDNFS* |
| Ga0181465_1010764 | 3300013870 | Clean Room | MGKEKKDKGVGDPIKILLEGALKKQRNVMVDKFAQILQ* |
| Ga0181465_1011743 | 3300013870 | Clean Room | MADEKKDEGAGDPIKILLEEALERQRNVMMDSFAQIL* |
| Ga0181465_1014586 | 3300013870 | Clean Room | MGEENKDEGAGDTIKIFLKEALEKQTNAVMDNFA* |
| Ga0181465_1027585 | 3300013870 | Clean Room | MEVEKKDKRVGDPIKILLKDALEKQRNVMMDNFSQILQ* |
| Ga0181465_1035206 | 3300013870 | Clean Room | MGDEKKDKGPGDPIKIFLEEALEKKMNAMMDNFAQILQ* |
| Ga0181465_1035207 | 3300013870 | Clean Room | MVEEKKDEGVGDPIKILLEEALKKQKNTMMDNFAQILQ* |
| Ga0181466_100022928 | 3300013871 | Clean Room | MADEKNDKGAGDPIKILLEEALERQQNAMMDSFAQIL* |
| Ga0181463_100002129 | 3300013872 | Clean Room | MEDENKYEGEGDPIKILLEEALKQKRNTLMENFAQIL* |
| Ga0181463_10015217 | 3300013872 | Clean Room | MASQADEKKDDGVRDPIKIFLEEALEKQRNMMMDNFA* |
| Ga0181463_10097372 | 3300013872 | Clean Room | MVDEKKDDEVGDPIKIFLEEALEQQRNTIMDNFA* |
| Ga0181463_10363371 | 3300013872 | Clean Room | MGEEMKDEGAGDPVKILLEEALKKQRNSVMNNIA* |
| Ga0181464_100015910 | 3300013873 | Clean Room | MVDEKKDEGAGAPIKILLEEALQQQRNKLMDSFAHIL* |
| Ga0181464_100087716 | 3300013873 | Clean Room | MADEKKDEGAGDPIKIFLEEALERQRNAMMDSFS* |
| Ga0181464_10021585 | 3300013873 | Clean Room | MREEKKDEGVGDPIKILLEEALEKQRNTMMDNFA* |
| Ga0181464_100224719 | 3300013873 | Clean Room | LEDEMKDEGTEDLIKILLEETIERKRNVMMDNFAQILQ* |
| Ga0181464_10044977 | 3300013873 | Clean Room | MADEKNDKGAGDPIKILLEEALEQQRNAMMDSFAQIL* |
| Ga0181464_10089745 | 3300013873 | Clean Room | MIDKKKVEGAGDPIKILLKEALMQKRNVMMDNFA* |
| Ga0181464_10299671 | 3300013873 | Clean Room | MADEKKNEGVGDPIKIFLEEALEQQRNTMMDSFTQIL* |
| Ga0181464_10317002 | 3300013873 | Clean Room | MGEENKDEGARDRIKILLEEALEKQRNTMMDKFAQILQ* |
| Ga0181464_10537471 | 3300013873 | Clean Room | MADEKKDEGAGDPIRILLEEALERQRNAMMDTFAQIL* |
| Ga0181464_10592702 | 3300013873 | Clean Room | MADEKKDEGVGDPIKIFLEEALKQQRNATMDNFA* |
| Ga0181451_104821 | 3300014120 | Clean Room | MVDENKDDGAGDPIKIFHEEALK*KRNVMMENFAQILQ* |
| Ga0135143_100271 | 3300014228 | Indoor Hospital Air | MADEKKDEGAGDPIKILLEEALERQRNAMMDSFVQI |
| Ga0135126_101312 | 3300014243 | Indoor Hospital Air | MADEKKDEGAGDPIKILLEEALERQRNAMMDSFAQILQRLPR |
| Ga0182125_10010872 | 3300015291 | Miscanthus Phyllosphere | MGDKKKDEGAGYPIKILLEEALEKQRNAMMDNFA* |
| Ga0182126_10074432 | 3300015294 | Miscanthus Phyllosphere | MVEEKKDEGAGDPIKILLEEPLEKQRNAMMDKFSQILQ* |
| Ga0182121_10468782 | 3300015316 | Switchgrass Phyllosphere | MGDEKKDEGAGDPIKILLKEALEKQRNAMMDNFA* |
| Ga0182121_11321191 | 3300015316 | Switchgrass Phyllosphere | MGDEKKDEGAGDPIKILLEEALEKQRNAMMDNFA* |
| Ga0182127_10474151 | 3300015321 | Miscanthus Phyllosphere | MGDKKKDEGAADPIKILLEEALEKQSNTMMDNFAQILQRLP |
| Ga0182134_10110033 | 3300015324 | Switchgrass Phyllosphere | MGDEKKDEGAGDPIKIFLEEALERQRNVMMDNFAQILQRLP |
| Ga0187901_108188711 | 3300019378 | Goat Feces | MADEKKDEGAGDPIKILLEEALERQRNAMMDSFAQILQ |
| Ga0213497_10002305 | 3300020586 | Leaf | QPRKTRRPPMAEEKKDEGAGGPLKMLPEESLERYRDAMMDKFAQFL |
| Ga0213497_10231582 | 3300020586 | Leaf | MEDEKKDEGAGDHIKILLEEALERQRNTMMDNFAHIL |
| Ga0213497_10524851 | 3300020586 | Leaf | MVDEKKEEGAGDPIKILLEEALERQRNAMMDSFSQILQ |
| Ga0213497_10582622 | 3300020586 | Leaf | MGEEKKDEGAGDPIKIFLEEALEKQRNMMMGNFSQILQR |
| Ga0213497_10644141 | 3300020586 | Leaf | MADEKNDEGKRDPIKFLLEEALERQRNAIMDNFSQIL |
| Ga0213495_100033132 | 3300020588 | Leaf | MAEEKKDEGAGGPLKMLPEESLERYRDAMMDKFSQFL |
| Ga0213495_100124511 | 3300020588 | Leaf | PRKTRRPPMAEEKKDEGAGGPLKMLPEESLERYRDAMMDKFAQFL |
| Ga0213495_100848531 | 3300020588 | Leaf | KPQQPPMVEEKKDKGAGDPFKMLGEEALKRQRNVMIDNFA |
| Ga0213495_100898171 | 3300020588 | Leaf | EDQPHKSRRPPMVDEKKDEGVGDPIKILLKEALKQQTNAMMDIFA |
| Ga0213496_100001594 | 3300020590 | Leaf | MAEEKKDEGAGGPLKMLPEESLERYRDAMMDKFAQFL |
| Ga0213496_100053212 | 3300020590 | Leaf | PRKTRRPPMAEEKKDEGAGGPLKMLPEESLERYRDAMMDKFSQFL |
| Ga0213496_100078632 | 3300020590 | Leaf | MADEKKDEGARDPIKILLKEALERQRNAMMHNFAQIL |
| Ga0213496_100117792 | 3300020590 | Leaf | MVDEKKDEGAGDPIKILLKEALKQQRNATMDNFAKIL |
| Ga0213496_100724912 | 3300020590 | Leaf | MADEKKDKGAGDPIKILLEESLKRQRNAMMDNFVQIL |
| Ga0213498_100205181 | 3300020600 | Leaf | KSQRPPMAEEKKDEGTGDPMKILLEEALKRQRNVMREHSAQEQLL |
| Ga0213498_100229891 | 3300020600 | Leaf | MVEEKKDKGVGDPFKTLLEEALERQRNAMMDNFSQIL |
| Ga0213498_100249532 | 3300020600 | Leaf | PMVDERKYEGAGDVIKILPEEALEQQRNAMMDNFA |
| Ga0213498_100561461 | 3300020600 | Leaf | KVEEKKDKGAGDTFKMLLKEAIEPQRDVMMDNFAQIL |
| Ga0213498_100580571 | 3300020600 | Leaf | MTDEKKDEGEGDPIKILLEEALKRQRNVMMDNFAQILQQIPRGNA |
| Ga0213498_101076562 | 3300020600 | Leaf | MADEKKDEGAGDLIKILLEEALERQRNAMMDNFTQILQRLPRNE |
| Ga0213500_100310901 | 3300020602 | Leaf | MAEEKRDKEAGDPIKMFLEEAFVRQQNKIMDSFAQILR |
| Ga0213500_100497661 | 3300020602 | Leaf | MAEETRYDEAGDPIKMLLEEALAQQRNEMMDNFTQIL |
| Ga0213500_100520381 | 3300020602 | Leaf | MEDENRDDGAGYLIKMFLEEALTQQRNEMMDNFTQILRRMLAATKE |
| Ga0214090_101568922 | 3300020816 | Food Waste | MAEENKDKGARDPIKILLDEALEKQRNAMMDNFAQSLQRL |
| Ga0233333_10003642 | 3300023016 | Leaf Litter | MAEEKRDDGAGDPIKSLLEEALERQRNEMMDSFAQILRRMPT |
| Ga0233330_10300401 | 3300023036 | Leaf Litter | MGEEKKVEDAEDPIKMFLEEALEKQRNAMMDNFTQIL |
| Ga0233346_10004311 | 3300023043 | Leaf Litter | MAEEKRDDGAGDPIKSLLEEALERQRNEMMDSFAQILRRMPA |
| Ga0224575_1092121 | 3300023224 | Roots | MGDEKKDDGAGDPIKMLLEEALVRQRNEMMDNFAQILQW |
| Ga0255813_118630441 | 3300023280 | Food Waste | MAEEKKDKGARDPIKILLEEALVKQRNAMMDNFAHSLQPSP |
| Ga0256703_106826101 | 3300023291 | Food Waste | PRRLPMAREKKEEGAGDPIKILLEEALEKQRNVMMDNFAQILQ |
| Ga0179587_103636581 | 3300026557 | Vadose Zone Soil | MAEEKRHDGAGDPIKSLLEEALERQRNEMMDSFTQIL |
| Ga0170818_1110239781 | 3300031474 | Forest Soil | MAEEKRDEKVGDPIKVFLKEALARQRNAMMDNFAQILXQ |
| Ga0310686_1007478111 | 3300031708 | Soil | MGEEKKYEGVGDPIKMLLEEALEKQRNAMMDNFAQILQRIP |
| Ga0310686_1087756302 | 3300031708 | Soil | MGDEKKDDGAGDPFKMFLKESLAQKRNKMMDNFAQILH |
| Ga0310686_1090084801 | 3300031708 | Soil | MGGENKDEGERDPIKLLLEEALEKQRNMMMDNFAQILQ |
| Ga0310686_1116642591 | 3300031708 | Soil | SMAGENKDDEKGDPFKISLEKALERQRNKMMDKFSKILQ |
| Ga0310686_1131511792 | 3300031708 | Soil | PMGDENKYEGVEDPIKILLNEALEKKRNAMMDNFA |
| Ga0310686_1178119832 | 3300031708 | Soil | MGEEMKDKGAVYPIKLLIKEALKKERNAMIDNFAQILQ |
| Ga0310686_1180486381 | 3300031708 | Soil | MGNKKKDDGARDHFKLLLEEALSRKRNEMMDNFAQILQR |
| Ga0310686_1187568981 | 3300031708 | Soil | MVGEKKDDGIGYPFKILIEEALTLQRNEMMDSFAQILR |
| Ga0268251_102284551 | 3300032159 | Agave | MAEEKKDEGAGDPIKILLEEALEKQRNAMMDKFAQILQRL |
| Ga0214482_10907581 | 3300032468 | Switchgrass Phyllosphere | MAEEKKDEGAGDPFKILLKEALEKHRNAMMDNIAQILR |
| Ga0348332_105408083 | 3300032515 | Plant Litter | MGDEKKDGGAGDPIKMLLEEALARQRKEMMDNFTQIL |
| Ga0321339_11330671 | 3300032551 | Switchgrass Phyllosphere | MVDEKKDEGARDLIKILLEEALEKQRNAMMDKFAQILQRLPTGD |
| Ga0321339_11546801 | 3300032551 | Switchgrass Phyllosphere | MAEGKKDEGAGDPIKILLEEALKKQKNVMMNNFAQILQ |
| Ga0316215_10063102 | 3300033544 | Roots | MGDEKKDEGAGDPIKIFVEGALEKQRNAMMDNFAQILQ |
| Ga0316216_10205561 | 3300033548 | Roots | MGEEKKDEGAGDPIKMLLEEALEKQRNMMMDNFAQILQRI |
| Ga0316216_10228411 | 3300033548 | Roots | MGDEKKDEGAGDPIKIFVEGALEKQRNAMMDNFAQILQXL |
| ⦗Top⦘ |