3300006491: Human anterior nares microbial communities from NIH, USA - visit 1, subject 763901136

Overview

Basic Information

• IMG/M Taxon OID: 3300006491
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052538 | Ga0100376
• Sample Name: Human anterior nares microbial communities from NIH, USA - visit 1, subject 763901136
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 2976360
• Sequencing Scaffolds: 2
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Respiratory System → Nasopharyngeal → Anterior Nares → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023843	Metagenome / Metatranscriptome	208	Y
F046363	Metagenome / Metatranscriptome	151	Y
F065766	Metagenome / Metatranscriptome	127	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0100376_10271	All Organisms → Viruses → Predicted Viral	1172
Ga0100376_10301	Not Available	795

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0100376_10271	Ga0100376_102713	F023843	MASSGKIEIEKFNGQSFELWKLKMEDLLVDKDQWIAVDPGTKPT*
Ga0100376_10271	Ga0100376_102714	F046363	MVFRSMVLDASACINMYCNIERNIMKNQARSLGFEIQWEISVYMCFMCYALAFYFSCDLEFVCR*
Ga0100376_10301	Ga0100376_103011	F065766	MADEKKDEGAGDPIKILLEEALERQRNTMMDNFA*