3300014243: Indoor hospital air microbial communities from San Diego, USA - 174_L1_2014-4-30

Overview

Basic Information

• IMG/M Taxon OID: 3300014243
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121326 | Gp0152458 | Ga0135126
• Sample Name: Indoor hospital air microbial communities from San Diego, USA - 174_L1_2014-4-30
• Sequencing Status: Permanent Draft
• Sequencing Center: San Diego State University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 2144229
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Indoor Hospital Air Microbial Communities From San Diego, Usa
• Type: Environmental
• Taxonomy: Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air → Indoor Hospital Air Microbial Communities From San Diego, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Aerosol (non-saline)

Location Information

• Location: USA: San Diego, California
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065766	Metagenome / Metatranscriptome	127	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0135126_10131	Not Available	779

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0135126_10131	Ga0135126_101312	F065766	MADEKKDEGAGDPIKILLEEALERQRNAMMDSFAQILQRLPR