| Basic Information | |
|---|---|
| Family ID | F063069 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 44 residues |
| Representative Sequence | FNSSLILELNRPIKKLCPIQEKKVKTKPKIIILKLDLTISIIIL |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.33 % |
| % of genes near scaffold ends (potentially truncated) | 96.15 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.154 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (17.692 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.231 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (70.769 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF14833 | NAD_binding_11 | 42.31 |
| PF03446 | NAD_binding_2 | 41.54 |
| PF00578 | AhpC-TSA | 8.46 |
| PF01075 | Glyco_transf_9 | 2.31 |
| PF00132 | Hexapep | 1.54 |
| PF08544 | GHMP_kinases_C | 0.77 |
| PF00534 | Glycos_transf_1 | 0.77 |
| PF01370 | Epimerase | 0.77 |
| PF12766 | Pyridox_oxase_2 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 2.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.15 % |
| Unclassified | root | N/A | 33.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000163|LPjun09P162000mDRAFT_c1045602 | Not Available | 596 | Open in IMG/M |
| 3300000209|LPaug08P202000mDRAFT_c1031603 | Not Available | 500 | Open in IMG/M |
| 3300001046|JGI12195J13216_1006683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1083 | Open in IMG/M |
| 3300001068|JGI12207J13218_1002720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2097 | Open in IMG/M |
| 3300001579|JGI11834J15748_1005437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 981 | Open in IMG/M |
| 3300001763|supr51_1006063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1993 | Open in IMG/M |
| 3300002919|JGI26061J44794_1003619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5322 | Open in IMG/M |
| 3300005399|Ga0066860_10201178 | Not Available | 677 | Open in IMG/M |
| 3300005424|Ga0066826_10150238 | Not Available | 824 | Open in IMG/M |
| 3300005424|Ga0066826_10222724 | Not Available | 646 | Open in IMG/M |
| 3300005945|Ga0066381_10176049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 613 | Open in IMG/M |
| 3300006002|Ga0066368_10218492 | Not Available | 649 | Open in IMG/M |
| 3300006012|Ga0066374_10212746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 565 | Open in IMG/M |
| 3300006019|Ga0066375_10084198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1028 | Open in IMG/M |
| 3300006079|Ga0081601_1044111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1494 | Open in IMG/M |
| 3300006166|Ga0066836_10242423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1075 | Open in IMG/M |
| 3300006308|Ga0068470_1660417 | Not Available | 728 | Open in IMG/M |
| 3300006310|Ga0068471_1272307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1788 | Open in IMG/M |
| 3300006310|Ga0068471_1353087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3114 | Open in IMG/M |
| 3300006313|Ga0068472_10549061 | Not Available | 711 | Open in IMG/M |
| 3300006316|Ga0068473_1442339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 999 | Open in IMG/M |
| 3300006318|Ga0068475_1365163 | Not Available | 699 | Open in IMG/M |
| 3300006323|Ga0068497_1127580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1307 | Open in IMG/M |
| 3300006330|Ga0068483_1438324 | Not Available | 521 | Open in IMG/M |
| 3300006331|Ga0068488_1297669 | Not Available | 623 | Open in IMG/M |
| 3300006331|Ga0068488_1310580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 972 | Open in IMG/M |
| 3300006331|Ga0068488_1513390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 669 | Open in IMG/M |
| 3300006331|Ga0068488_1651073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1107 | Open in IMG/M |
| 3300006336|Ga0068502_1405320 | Not Available | 789 | Open in IMG/M |
| 3300006336|Ga0068502_1479229 | Not Available | 940 | Open in IMG/M |
| 3300006339|Ga0068481_1399499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1139 | Open in IMG/M |
| 3300006340|Ga0068503_10513899 | Not Available | 545 | Open in IMG/M |
| 3300006341|Ga0068493_10598113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1285 | Open in IMG/M |
| 3300006341|Ga0068493_10698153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 706 | Open in IMG/M |
| 3300006341|Ga0068493_10752070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 945 | Open in IMG/M |
| 3300006414|Ga0099957_1245578 | Not Available | 560 | Open in IMG/M |
| 3300006565|Ga0100228_1114348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 525 | Open in IMG/M |
| 3300006900|Ga0066376_10713050 | Not Available | 550 | Open in IMG/M |
| 3300007160|Ga0099959_1088835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1327 | Open in IMG/M |
| 3300007283|Ga0066366_10246369 | Not Available | 746 | Open in IMG/M |
| 3300007509|Ga0105012_1159806 | Not Available | 815 | Open in IMG/M |
| 3300007512|Ga0105016_1229524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 866 | Open in IMG/M |
| 3300007770|Ga0105015_1106983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1033 | Open in IMG/M |
| 3300008097|Ga0111541_10264203 | Not Available | 731 | Open in IMG/M |
| 3300008225|Ga0105352_1117430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 601 | Open in IMG/M |
| 3300008252|Ga0105357_10046736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2025 | Open in IMG/M |
| 3300008735|Ga0115657_1181509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1135 | Open in IMG/M |
| 3300008954|Ga0115650_1187739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1291 | Open in IMG/M |
| 3300009104|Ga0117902_1188130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2067 | Open in IMG/M |
| 3300009104|Ga0117902_1625626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 848 | Open in IMG/M |
| 3300009109|Ga0117922_1028631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3598 | Open in IMG/M |
| 3300009376|Ga0118722_1072474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2534 | Open in IMG/M |
| 3300009376|Ga0118722_1096739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2052 | Open in IMG/M |
| 3300009481|Ga0114932_10221409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1147 | Open in IMG/M |
| 3300009703|Ga0114933_10271808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1130 | Open in IMG/M |
| 3300009703|Ga0114933_10558771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 740 | Open in IMG/M |
| 3300009706|Ga0115002_10256247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1336 | Open in IMG/M |
| 3300020272|Ga0211566_1020864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1584 | Open in IMG/M |
| 3300020300|Ga0211662_1025012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1157 | Open in IMG/M |
| 3300020324|Ga0211630_1088067 | Not Available | 628 | Open in IMG/M |
| 3300020330|Ga0211572_1008998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3284 | Open in IMG/M |
| 3300020357|Ga0211611_1095570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 710 | Open in IMG/M |
| 3300020375|Ga0211656_10158836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 690 | Open in IMG/M |
| 3300020383|Ga0211646_10258304 | Not Available | 618 | Open in IMG/M |
| 3300020389|Ga0211680_10091386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1284 | Open in IMG/M |
| 3300020389|Ga0211680_10246976 | Not Available | 672 | Open in IMG/M |
| 3300020395|Ga0211705_10290002 | Not Available | 605 | Open in IMG/M |
| 3300020407|Ga0211575_10125435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1071 | Open in IMG/M |
| 3300020415|Ga0211553_10106010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1166 | Open in IMG/M |
| 3300020435|Ga0211639_10020146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 3068 | Open in IMG/M |
| 3300020443|Ga0211544_10404015 | Not Available | 547 | Open in IMG/M |
| 3300020451|Ga0211473_10061987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1882 | Open in IMG/M |
| 3300020465|Ga0211640_10528557 | Not Available | 641 | Open in IMG/M |
| 3300020478|Ga0211503_10256850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 966 | Open in IMG/M |
| 3300021068|Ga0206684_1165516 | Not Available | 726 | Open in IMG/M |
| 3300021442|Ga0206685_10235727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 618 | Open in IMG/M |
| 3300021791|Ga0226832_10065599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1276 | Open in IMG/M |
| 3300021977|Ga0232639_1259728 | Not Available | 665 | Open in IMG/M |
| 3300021979|Ga0232641_1062285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1421 | Open in IMG/M |
| 3300022227|Ga0187827_10362520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 912 | Open in IMG/M |
| 3300025186|Ga0208056_107461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1324 | Open in IMG/M |
| 3300025193|Ga0208061_121021 | Not Available | 620 | Open in IMG/M |
| 3300025234|Ga0208837_1015228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1226 | Open in IMG/M |
| 3300025265|Ga0208467_1002749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4252 | Open in IMG/M |
| 3300025863|Ga0208833_1011854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1811 | Open in IMG/M |
| 3300026084|Ga0208881_1042514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 945 | Open in IMG/M |
| 3300026086|Ga0207964_1143501 | Not Available | 548 | Open in IMG/M |
| 3300026087|Ga0208113_1021307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. RS40 | 2000 | Open in IMG/M |
| 3300026119|Ga0207966_1111785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 630 | Open in IMG/M |
| 3300026190|Ga0207987_1024310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 830 | Open in IMG/M |
| 3300026257|Ga0208407_1066207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1183 | Open in IMG/M |
| 3300026265|Ga0208765_1054755 | Not Available | 1132 | Open in IMG/M |
| 3300026268|Ga0208641_1084199 | Not Available | 922 | Open in IMG/M |
| 3300026269|Ga0208766_1056621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1208 | Open in IMG/M |
| 3300027699|Ga0209752_1131054 | Not Available | 731 | Open in IMG/M |
| 3300028190|Ga0257108_1050560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. RS40 | 1249 | Open in IMG/M |
| 3300028190|Ga0257108_1131006 | Not Available | 734 | Open in IMG/M |
| 3300028488|Ga0257113_1073096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1080 | Open in IMG/M |
| 3300028488|Ga0257113_1180311 | Not Available | 625 | Open in IMG/M |
| 3300028535|Ga0257111_1199024 | Not Available | 597 | Open in IMG/M |
| 3300031757|Ga0315328_10794274 | Not Available | 530 | Open in IMG/M |
| 3300031801|Ga0310121_10520374 | Not Available | 656 | Open in IMG/M |
| 3300031801|Ga0310121_10538973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 640 | Open in IMG/M |
| 3300031802|Ga0310123_10329502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 997 | Open in IMG/M |
| 3300031811|Ga0310125_10553921 | Not Available | 542 | Open in IMG/M |
| 3300031861|Ga0315319_10353085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 739 | Open in IMG/M |
| 3300031861|Ga0315319_10378481 | Not Available | 711 | Open in IMG/M |
| 3300031861|Ga0315319_10447675 | Not Available | 647 | Open in IMG/M |
| 3300031886|Ga0315318_10409860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 775 | Open in IMG/M |
| 3300031886|Ga0315318_10805080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 523 | Open in IMG/M |
| 3300032006|Ga0310344_10172413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1834 | Open in IMG/M |
| 3300032006|Ga0310344_10763422 | Not Available | 821 | Open in IMG/M |
| 3300032006|Ga0310344_11157697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 643 | Open in IMG/M |
| 3300032006|Ga0310344_11181047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 635 | Open in IMG/M |
| 3300032006|Ga0310344_11592531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 530 | Open in IMG/M |
| 3300032032|Ga0315327_10368747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 900 | Open in IMG/M |
| 3300032032|Ga0315327_10693159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 624 | Open in IMG/M |
| 3300032088|Ga0315321_10233724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1195 | Open in IMG/M |
| 3300032130|Ga0315333_10538230 | Not Available | 547 | Open in IMG/M |
| 3300032134|Ga0315339_1125798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 779 | Open in IMG/M |
| 3300032134|Ga0315339_1221169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 502 | Open in IMG/M |
| 3300032278|Ga0310345_10325146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1431 | Open in IMG/M |
| 3300032278|Ga0310345_10513329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1145 | Open in IMG/M |
| 3300032278|Ga0310345_10610037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1051 | Open in IMG/M |
| 3300032278|Ga0310345_10678112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 997 | Open in IMG/M |
| 3300032278|Ga0310345_12033633 | Not Available | 558 | Open in IMG/M |
| 3300032278|Ga0310345_12119304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 545 | Open in IMG/M |
| 3300032360|Ga0315334_10471882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1071 | Open in IMG/M |
| 3300032360|Ga0315334_10580349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 965 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.69% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 13.08% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 12.31% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 10.77% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 9.23% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 7.69% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.92% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 6.15% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 6.15% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 2.31% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.31% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.54% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 1.54% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.77% |
| Diffuse Hydrothermal Fluid | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid | 0.77% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000163 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 2000m | Environmental | Open in IMG/M |
| 3300000209 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P20 2000m | Environmental | Open in IMG/M |
| 3300001046 | Marine microbial communities from the Deep Indian Ocean - MP1202 | Environmental | Open in IMG/M |
| 3300001068 | Marine microbial communities from the Deep Atlantic Ocean - MP0372 | Environmental | Open in IMG/M |
| 3300001579 | Marine microbial communities from the Deep Atlantic Ocean - MP0740 | Environmental | Open in IMG/M |
| 3300001763 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Beebe Supr51 | Environmental | Open in IMG/M |
| 3300002919 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300005399 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275 | Environmental | Open in IMG/M |
| 3300005424 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV49 | Environmental | Open in IMG/M |
| 3300005945 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B | Environmental | Open in IMG/M |
| 3300006002 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A | Environmental | Open in IMG/M |
| 3300006012 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006079 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid D | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
| 3300006316 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000m | Environmental | Open in IMG/M |
| 3300006318 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0200m | Environmental | Open in IMG/M |
| 3300006323 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0500m | Environmental | Open in IMG/M |
| 3300006330 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_1000m | Environmental | Open in IMG/M |
| 3300006331 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006414 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0500m | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300007160 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_1000m | Environmental | Open in IMG/M |
| 3300007283 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B | Environmental | Open in IMG/M |
| 3300007509 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300007512 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300007770 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300008225 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN8B Hudson Canyon | Environmental | Open in IMG/M |
| 3300008252 | Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM15B Gulf of Mexico | Environmental | Open in IMG/M |
| 3300008735 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300008954 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009109 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300009376 | Combined Assembly of Gp0137079, Gp0137080 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300020272 | Marine microbial communities from Tara Oceans - TARA_B100001971 (ERX556120-ERR599127) | Environmental | Open in IMG/M |
| 3300020300 | Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX555977-ERR598981) | Environmental | Open in IMG/M |
| 3300020324 | Marine microbial communities from Tara Oceans - TARA_B100000678 (ERX555936-ERR599033) | Environmental | Open in IMG/M |
| 3300020330 | Marine microbial communities from Tara Oceans - TARA_B100001964 (ERX556097-ERR599147) | Environmental | Open in IMG/M |
| 3300020357 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX555950-ERR598956) | Environmental | Open in IMG/M |
| 3300020375 | Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX555974-ERR599132) | Environmental | Open in IMG/M |
| 3300020383 | Marine microbial communities from Tara Oceans - TARA_B100000929 (ERX556043-ERR598971) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020407 | Marine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115) | Environmental | Open in IMG/M |
| 3300020415 | Marine microbial communities from Tara Oceans - TARA_B100001146 (ERX555973-ERR599166) | Environmental | Open in IMG/M |
| 3300020435 | Marine microbial communities from Tara Oceans - TARA_B100000586 (ERX556070-ERR599086) | Environmental | Open in IMG/M |
| 3300020443 | Marine microbial communities from Tara Oceans - TARA_B100001179 (ERX556000-ERR598944) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021977 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS925 _150kmer | Environmental | Open in IMG/M |
| 3300021979 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS926 _150kmer | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025186 | Marine microbial communities from the Deep Pacific Ocean - MP2052 (SPAdes) | Environmental | Open in IMG/M |
| 3300025193 | Marine microbial communities from the Deep Atlantic Ocean - MP0555 (SPAdes) | Environmental | Open in IMG/M |
| 3300025234 | Marine microbial communities from the Deep Atlantic Ocean - MP0327 (SPAdes) | Environmental | Open in IMG/M |
| 3300025265 | Marine microbial communities from the Deep Pacific Ocean - MP2098 (SPAdes) | Environmental | Open in IMG/M |
| 3300025863 | Marine microbial communities from the Deep Pacific Ocean - MP1788 (SPAdes) | Environmental | Open in IMG/M |
| 3300026084 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026086 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026087 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026119 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026190 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF86A (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026265 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV203 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
| 3300027699 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_250m (SPAdes) | Environmental | Open in IMG/M |
| 3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
| 3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
| 3300028535 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500m | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300031811 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8 | Environmental | Open in IMG/M |
| 3300031861 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| 3300032134 | Ammonia-oxidizing marine archaeal communities from Pacific Ocean, United States - ASW #17 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPjun09P162000mDRAFT_10456021 | 3300000163 | Marine | MVPNSPWEIFNSSLILELNSPIKKLCPTEEKKVKTKPKTIILKFDLIISIIIINYEL* |
| LPaug08P202000mDRAFT_10316032 | 3300000209 | Marine | NRPIKKLCPMEEKKVKTKPKIIILKLDLTISIIIL* |
| JGI12195J13216_10066832 | 3300001046 | Deep Ocean | NSALEIFNSCLILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL* |
| JGI12207J13218_10027204 | 3300001068 | Deep Ocean | SXLILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL* |
| JGI11834J15748_10054371 | 3300001579 | Deep Ocean | MPNSPWEIFNSSLILELNSPIKKLCPTHEKKVKTKPKIIILKLDLTISIIMFNYEL* |
| supr51_10060634 | 3300001763 | Hydrothermal Vent Plume | LKLNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL* |
| JGI26061J44794_10036192 | 3300002919 | Marine | MPNSPWEIFNSSLILELNSPIKKLCPTHEKKVKIKPKIIILKLDLTYL* |
| Ga0066860_102011781 | 3300005399 | Marine | LILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL* |
| Ga0066826_101502381 | 3300005424 | Marine | PNSPWLILNSSLIFELNKPIKKLCPIQEKKVNIKPKIIILKLDLSISIIIL* |
| Ga0066826_102227241 | 3300005424 | Marine | IVPNSPCVIFNSSLILELNRPIKKLCPIQEKKVKTKPKIIILKLDLTISIIIL* |
| Ga0066381_101760491 | 3300005945 | Marine | ILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL* |
| Ga0066368_102184922 | 3300006002 | Marine | *EIFNSSLILELNKPIKKLCPTHEKKVKTKPKKIILKFDRIISIIIINYEL* |
| Ga0066374_102127461 | 3300006012 | Marine | LEIFNSCLILELNKPIKKLWPILEKKVKTKPKIIILKLDLTISIIIL*VAKLLL* |
| Ga0066375_100841982 | 3300006019 | Marine | PWEIFNSSLILELNSPIKKLCPTHEKKVKTKPKIIILKLDLTISIIMFNYEL* |
| Ga0081601_10441113 | 3300006079 | Diffuse Hydrothermal Fluid | ELNNPIKKLCPTHEKKVKTKPKKIILKFDLIISIIIINYEL* |
| Ga0066836_102424231 | 3300006166 | Marine | PNCPWLIFKSILILELNSPIKKLCPKLEKNVNINPKIIILKFDLIISIIIL* |
| Ga0068470_16604172 | 3300006308 | Marine | ILELNRPIKKLCPIEEKKVKTKPKIIIMKLDLTISIIIL* |
| Ga0068471_12723071 | 3300006310 | Marine | ILELNRPIKKLCPIHEKKVKTKPKIIILKLDLTILIIII* |
| Ga0068471_13530871 | 3300006310 | Marine | LNNPIKKLCPTDEKKVKTKPKRIILKFDLIISIIIINYEL* |
| Ga0068472_105490612 | 3300006313 | Marine | SPIKKLCPTLEKKVKTKPKKIILKFDLIISIIIINYEL* |
| Ga0068473_14423392 | 3300006316 | Marine | CVIFNSFLILELNRPIKKLCPIQEKKVKTKPKIIILKLDLTISIIII* |
| Ga0068475_13651631 | 3300006318 | Marine | FNSFLISELNNPIKKLCPTDDAKRKTNANNIILKFDLIVSIIIL*LVMLLS* |
| Ga0068497_11275801 | 3300006323 | Marine | LNNPIKKLCPVHEKKVKTKPKKIILKFDLIISIIIINHEL* |
| Ga0068483_14383241 | 3300006330 | Marine | KKLCPTDEKKVKTKPKKIILKFDLIIFIIIINYEL* |
| Ga0068488_12976692 | 3300006331 | Marine | NSFLILELNNPIKKLCPTLEKKVKIKPKRIILKFDLIISIIIINYEL* |
| Ga0068488_13105802 | 3300006331 | Marine | VIFNSSLILELNRPIKKLCPIQEKKVKTKPKIIILKLDLTISIIIL* |
| Ga0068488_15133902 | 3300006331 | Marine | MVPNSPWEIFNSSLILELNSPIKKLCPTDEKKVKTKPKRIILKFDLIISIIIINYELQRFFYWPWCNG |
| Ga0068488_16510731 | 3300006331 | Marine | KLELNSPIKKLCPTHEKKVKTKPKIIILKLDLTISIIMFIYEL* |
| Ga0068502_14053201 | 3300006336 | Marine | WVIFNSCLILELNSPIKKLWPIHEKNVKTKPKIIILKLDLTISIIIV* |
| Ga0068502_14792292 | 3300006336 | Marine | LIFELNSPIKKLCPIDEKNVNTKPKIIILKLDLTISIIIL* |
| Ga0068481_13994991 | 3300006339 | Marine | FNSSLILELNRPIKKLCPIQEKKVKTKPKIIILKLDLTISIIIL* |
| Ga0068503_105138991 | 3300006340 | Marine | SPWVIFNSCLILELNRPIKKLCPIEEKKVKTKPKIIILKLDLTISIIIL* |
| Ga0068493_105981133 | 3300006341 | Marine | CEMFNSSLILELKRPIKKLCPIQEKKVKTKPKIIILKLDLTISIIIL* |
| Ga0068493_106981531 | 3300006341 | Marine | ILELNRPIKKLWPIQEKKVKTKPKIIILKLDLTISIIIF* |
| Ga0068493_107520702 | 3300006341 | Marine | MFNSSLILELNRPIKKLWPIQEKKVKIKPKIIILKLDLTISIIIL* |
| Ga0099957_12455782 | 3300006414 | Marine | KLCPTDEKKVKTKPKIIILKFDLIISIIIINYEL* |
| Ga0100228_11143482 | 3300006565 | Marine | LELNRPIKKLCPIQEKKVKIKPKIIILKLDLTISIIIL* |
| Ga0066376_107130502 | 3300006900 | Marine | NSPIKKLCPMEEKKVKTKPKIIILKLDLTISIIMFNYEL* |
| Ga0099959_10888353 | 3300007160 | Marine | SSLILELNKPIKKLCPTHEKKVKTKPKKIILKFDRIISIIIINYEL* |
| Ga0066366_102463692 | 3300007283 | Marine | PWVIFNSCLISELNRPIKKLWPTQEKKVKTKPKIIILKLDLSISIIIV* |
| Ga0105012_11598061 | 3300007509 | Marine | RDPNSPWLIFNSSLILELNRPIKKLWPIHEKKVKTKPKIIILKFDLTISIIIL* |
| Ga0105016_12295242 | 3300007512 | Marine | ALEIFNSCLISELNKPIKKLWPMLEKKVKTNPKIIILKLDLTISIIIL* |
| Ga0105015_11069831 | 3300007770 | Marine | NSSLISELNKPIKKLCPMLEKKVKTKPKIIILKLDLTISIIIL* |
| Ga0111541_102642031 | 3300008097 | Marine | MFSSFLISELNKPIKKLWPIHEKKVKTKPKIIILKFDLIISIIIKCL* |
| Ga0105352_11174302 | 3300008225 | Methane Seep Mesocosm | EIFNSSLIFELNNPIKKLCPTHEKKVKVTPKIIILKFDLTISIIIL* |
| Ga0105357_100467361 | 3300008252 | Methane Seep Mesocosm | SPWEIFNSSLILELNSPIKKLCPTHEKKVKIKPKIIILKLDLTISIIMFNYEL* |
| Ga0115657_11815093 | 3300008735 | Marine | PYVMFNSSLILELKRPIKKLCPIQEKKVKTKPNIIILKLDLTISIIIV* |
| Ga0115650_11877391 | 3300008954 | Marine | LNSSLIFELNKPIKKLCPIQEKKVNIKPKIIILKLDLSISIIIL* |
| Ga0117902_11881301 | 3300009104 | Marine | PWVILSSSLILELNRPIKKLCPIQEKKVNTKPKIIILKLDLSVSIIIL* |
| Ga0117902_16256262 | 3300009104 | Marine | LNRPRKKLCPMDEKNVKTKPKIIILKLDLTISIIIL* |
| Ga0117922_10286311 | 3300009109 | Marine | FNSSLILELNIPIKKLCPMHEKKVNIKPKIIILKLDLTVSIIIL* |
| Ga0118722_10724741 | 3300009376 | Marine | LTLELNKPIKKLCPMHEKKVKTKPKIIILKFDLTELIIIL* |
| Ga0118722_10967391 | 3300009376 | Marine | NSPWVIFNSSLILELNRPIKKLWPIQEKKVKTKPKIIILKLDLTISIIIV* |
| Ga0114932_102214091 | 3300009481 | Deep Subsurface | ISELNKPIKKLCPMLEKKVKTKPKIIILKLDLTVSIIIL* |
| Ga0114933_102718082 | 3300009703 | Deep Subsurface | MFNSSLILELNRPIKKLWPIHEKKVKTKPKIIILKLDLTVLIIIL* |
| Ga0114933_105587711 | 3300009703 | Deep Subsurface | NKPIKKLCPMLEKKVKTKPKIIILKLDLTISIIIL* |
| Ga0115002_102562471 | 3300009706 | Marine | NNPIKKLCPTHEKKVKVMPKIIILKFDLTISIIIL* |
| Ga0163108_100064661 | 3300012950 | Seawater | PNSAYPIFNSFLISELNRPIKKLCPMHEKKVKTKLNIIILELSLFII* |
| Ga0211566_10208641 | 3300020272 | Marine | DPNSALEIFNSCLILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| Ga0211662_10250123 | 3300020300 | Marine | IFELNKPIKKLCPIQEKKVNIKPKIIILKLDLSISIIIL |
| Ga0211630_10880671 | 3300020324 | Marine | PIKKLXPTHEKNVKTKPKIIILKLDLIISIIIIIYEL |
| Ga0211572_10089981 | 3300020330 | Marine | IFNSCLILELNRPRKKLWPMQEKKVKTKPKIIILKFDLTISIIIV |
| Ga0211611_10955702 | 3300020357 | Marine | NSALVIFNSSLISELNKPIKKLCPMLEKKVKTKPKIIILKLDLTISIIILXVAKLLL |
| Ga0211656_101588361 | 3300020375 | Marine | NSCLILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| Ga0211646_102583041 | 3300020383 | Marine | FELNKPIKKLCPMQEKKVKIKPKIIILKLDLTISIIIL |
| Ga0211680_100913861 | 3300020389 | Marine | LNRPIKKLWPIQEKKVKTKPKIIILKLDLTISIIIV |
| Ga0211680_102469761 | 3300020389 | Marine | LNRPIKKLWPIQEKKVKTKPKIIILILDLSISIIIV |
| Ga0211705_102900022 | 3300020395 | Marine | SSFLISELNKPIKKLWPIHEKKVKTKPKIIILKFDLIISIIIKCL |
| Ga0211575_101254351 | 3300020407 | Marine | LNNPIKKLCPTHEKKVKVIPKIIILKFDLTISIIIL |
| Ga0211553_101060101 | 3300020415 | Marine | FNSCLILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| Ga0211639_100201461 | 3300020435 | Marine | FNSCLILELNRPIKKLWPMQEKKVKTKPKIIILKFDLTISIIIV |
| Ga0211544_104040151 | 3300020443 | Marine | LNRPIKKLCPIQEKKVKTNPKIIILKLDLTISIIIL |
| Ga0211473_100619871 | 3300020451 | Marine | ISELNSPIKKLCPMHEKKVKTNPKIIILKFDLIVSIIIL |
| Ga0211640_105285571 | 3300020465 | Marine | SSSLILELNRPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| Ga0211503_102568501 | 3300020478 | Marine | ISELKSPIKKLCPIEEKNVNTKPKIIILKLDLTISIIIL |
| Ga0206684_11655161 | 3300021068 | Seawater | LELNSPIKKLWPIHEKKVKTKPKIIILKLDLTISIIIL |
| Ga0206685_102357271 | 3300021442 | Seawater | SCLILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| Ga0226832_100655991 | 3300021791 | Hydrothermal Vent Fluids | VIFNSFLILELNSPIKKLWPIQEKKVKTKPKIIILKLDLTISIIIV |
| Ga0232639_12597281 | 3300021977 | Hydrothermal Vent Fluids | NSPWVIFNSSLMLELNNPIKKLWPTHEKNVKAKPKIIILKLDLTISIIIFNYEL |
| Ga0232641_10622851 | 3300021979 | Hydrothermal Vent Fluids | NSPWEIFNSSLILELNSPIKKLCPTHEKKVKIKPKIIILKLDLTISIIMFNYEL |
| Ga0187827_103625202 | 3300022227 | Seawater | WLILNSSLIFELNKPIKKLCPIQEKKVNIKPKIIILKLDLSISIIIL |
| Ga0208056_1074611 | 3300025186 | Deep Ocean | IDPNSALEIFNSCLILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| Ga0208061_1210212 | 3300025193 | Deep Ocean | PWEIFNSSLILELNSPIKKLCPTHEKKVKIKPKIIILKLDLTISIIMFNYEL |
| Ga0208837_10152283 | 3300025234 | Deep Ocean | EIFNSSLILELNSPIKKLCPTHEKKVKIKPKIIILKLDLTISIIMFNYEL |
| Ga0208467_10027497 | 3300025265 | Deep Ocean | SCLILELNRPRKKLWPMQEKKVKTKPKIIILKFDLTISIIIV |
| Ga0208833_10118541 | 3300025863 | Deep Ocean | ILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| Ga0208881_10425141 | 3300026084 | Marine | SPCVIFNSSLIFELNRPIKKLWPMLEKKVKTKPKIIILKLDLTISIIIL |
| Ga0207964_11435011 | 3300026086 | Marine | ILELNRPIKKLWPMEEKKVKTKPKIIILKLDLTISIIIL |
| Ga0208113_10213071 | 3300026087 | Marine | NKPIKKLCPTHEKKVKIKPKRIILKFDLIIFIIIINYEL |
| Ga0207966_11117852 | 3300026119 | Marine | LNRPIKKLWPIQEKKVKTKPKIIILKLDLTISIIIL |
| Ga0207987_10243102 | 3300026190 | Marine | NRPIKKLCPIQEKKVKTKPKIIILKLDLTISIIIL |
| Ga0208407_10662071 | 3300026257 | Marine | LILELNRPIKKLWPILEKKVNTKPKIIILKLDLTISIIIL |
| Ga0208765_10547551 | 3300026265 | Marine | FLISELNRPIKKLCPMHEKKVKTKPKIIILKFDLIVSIIIL |
| Ga0208641_10841991 | 3300026268 | Marine | MIPNSALLIFNSFLISELNKPIKKLCPIHEKKVKTKPKIIILKFDLIISIIIL |
| Ga0208766_10566213 | 3300026269 | Marine | PCEMFNSSLILELNKPIKKLCPTHEKKVKIKPKIIILKFDLTISIIIL |
| Ga0209752_11310542 | 3300027699 | Marine | ELNKPIKKLWPILEKKVKTKPKIIILKLDLTISIIIV |
| Ga0257108_10505603 | 3300028190 | Marine | PCEMFNSPLIFELNNPIKKLCPTHEKKVKVMPKIIILKFDLTISIIIL |
| Ga0257108_11310061 | 3300028190 | Marine | KKLCPTDEKKVKTKPKRIILKFDLIISIIIINYEL |
| Ga0257113_10730962 | 3300028488 | Marine | LILELNRPIKKLWPIQEKKVNTKPKIIILKLDLTISIIIV |
| Ga0257113_11803112 | 3300028488 | Marine | SSLILELNRPIKKLWPMEEKKVKTKPKIIILKLDLTISIIIL |
| Ga0257111_11990241 | 3300028535 | Marine | MFNSSLIFELNRPIKKLCPIEEKNVKTKPKIIILKLDLTISIIIL |
| Ga0315328_107942741 | 3300031757 | Seawater | SCLILELNRPIKKLWPIQEKKVNTKPKIIILKLDLTISIIIV |
| Ga0310121_105203741 | 3300031801 | Marine | NKPIKKLCPTDEKKVKTKPKRIILKFDLIISIIIINNEL |
| Ga0310121_105389731 | 3300031801 | Marine | ELNKPKKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| Ga0310123_103295022 | 3300031802 | Marine | PIKKLCPTHEKKVKIKPKIIILKLDLTISIIMFNYEL |
| Ga0310125_105539212 | 3300031811 | Marine | FNSPLILELNRPIKKLWPIQEKKVKTKPKIIILKLGLTISIIIL |
| Ga0315319_103530852 | 3300031861 | Seawater | FNSCLILELNKPIKKLCPILEKKVKTKPKIIILKLDLTISIIIL |
| Ga0315319_103784811 | 3300031861 | Seawater | CEMFNSSLILELKRPIKKLWPIQEKKVKTKPKIIILKLDLTISIIIL |
| Ga0315319_104476752 | 3300031861 | Seawater | CVIFNSYLILELNRPIKKLWPIQEKKVKTKPKIIILKLDLTISIIIL |
| Ga0315318_104098602 | 3300031886 | Seawater | NSSLISELNKPIKKLCPILEKKVKTKPKIIILKLDLTISIIIL |
| Ga0315318_108050802 | 3300031886 | Seawater | PNSALEIFNSCLILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| Ga0310344_101724134 | 3300032006 | Seawater | IFELNRPMKKLCPIDEKKVKTKPKIIILKLDLTISIIIL |
| Ga0310344_107634221 | 3300032006 | Seawater | VIPSSSLIFELNKPIKKLWPIQEKKVKTNPKIIILKLDLTISIIIL |
| Ga0310344_111576972 | 3300032006 | Seawater | SALVIFNSSLISELNKPIKKLCPMLEKKVKTKPKIIILKLDLTISIIII |
| Ga0310344_111810472 | 3300032006 | Seawater | LISELNKPIKKLCPMLEKKVKTKPKIIILKLDLTISIIIL |
| Ga0310344_115925311 | 3300032006 | Seawater | VIFNSSLISELNKPIKKLCPMLEKKVKTKPKIIILKLDLTISIIIL |
| Ga0315327_103687472 | 3300032032 | Seawater | TELNRPIKKLCPIQEKKVKTKPKIIILKLDLTISIIIL |
| Ga0315327_106931592 | 3300032032 | Seawater | ELNRPIKKLWPIQENKVNTKPKIIILKLDLTVSIIIL |
| Ga0315321_102337241 | 3300032088 | Seawater | LILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| Ga0315333_105382302 | 3300032130 | Seawater | SLILELNRPIKKLWPIQEKKVNTKPKIIILKLDLTISIIIL |
| Ga0315339_11257982 | 3300032134 | Seawater | LISELNKPIKKLCPILEKKVKTKPKIIILKLDLTISIIIL |
| Ga0315339_12211691 | 3300032134 | Seawater | SELNKPIKKLCPMLEKKVKTKPKIIILKLDLTISIIIL |
| Ga0310345_103251461 | 3300032278 | Seawater | VPNSPWVIFNSSLILELNRPIKKLCPMEEKKVKTKPKIIILKLDLIISIIIL |
| Ga0310345_105133291 | 3300032278 | Seawater | VIFNSCLILELNRPIKKLWPMQEKKVKTKPKIIILKLDLTISIIIL |
| Ga0310345_106100372 | 3300032278 | Seawater | NSPCVIFNSFLISELNRPMKKLWPIQEKNVKTKPKIIILKFGLTISIIIL |
| Ga0310345_106781121 | 3300032278 | Seawater | CLILELNKPIQKLWPILEKKVKTKPKIIILKLDLTISIIIL |
| Ga0310345_120336331 | 3300032278 | Seawater | LIFELNNPIKKLCPTHEKKVKIKPNIIILKFDLTISIIIL |
| Ga0310345_121193041 | 3300032278 | Seawater | CLILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| Ga0315334_104718822 | 3300032360 | Seawater | IDPNSALLIFNSCLILELNKPIKKLWPILEKKVKTKPKIIILKLDLTISIIIL |
| Ga0315334_105803492 | 3300032360 | Seawater | LNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL |
| ⦗Top⦘ |