3300025186: Marine microbial communities from the Deep Pacific Ocean - MP2052 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300025186
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053074 | Gp0054313 | Ga0208056
• Sample Name: Marine microbial communities from the Deep Pacific Ocean - MP2052 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 55611151
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Ocean Microbial Communities From The Global Malaspina Expedition
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: West of Cabo San Lucas, Mexico, North Pacific Ocean
• Coordinates
  • Lat. (^o): 15.91
  • Long. (^o): -124.49
  • Alt. (m): N/A
  • Depth (m): 4002.4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063069	Metagenome	130	Y
F074977	Metagenome	119	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0208056_107461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter	1324
Ga0208056_121836	Not Available	535

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208056_107461	Ga0208056_1074611	F063069	IDPNSALEIFNSCLILELNKPIKKLWPILEKKVKTNPKIIILKLDLTISIIIL
Ga0208056_121836	Ga0208056_1218362	F074977	MTDLSDIVIYMKKLYNIFVKKYLLILLVSFGITACTKLSEVDNELIKFSADNLKESSQAKESFNKYGQVYYDIHLGRLCSPDGKAVSLIWLNQVDPKGKKITKDQLNVSKENCKNK