| Basic Information | |
|---|---|
| Family ID | F045728 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MQLASAPRESSGQNERPSMAVQAAPAPAGDSLLVSRFLPTR |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.71 % |
| % of genes near scaffold ends (potentially truncated) | 88.16 % |
| % of genes from short scaffolds (< 2000 bps) | 82.24 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.447 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (57.237 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.184 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.289 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF11731 | Cdd1 | 3.33 |
| PF05016 | ParE_toxin | 3.33 |
| PF03544 | TonB_C | 2.67 |
| PF00578 | AhpC-TSA | 2.00 |
| PF04402 | SIMPL | 2.00 |
| PF13905 | Thioredoxin_8 | 1.33 |
| PF08534 | Redoxin | 1.33 |
| PF01909 | NTP_transf_2 | 1.33 |
| PF05168 | HEPN | 1.33 |
| PF00041 | fn3 | 1.33 |
| PF14294 | DUF4372 | 1.33 |
| PF14054 | DUF4249 | 1.33 |
| PF00226 | DnaJ | 0.67 |
| PF16301 | DUF4943 | 0.67 |
| PF13374 | TPR_10 | 0.67 |
| PF12704 | MacB_PCD | 0.67 |
| PF00069 | Pkinase | 0.67 |
| PF14358 | DUF4405 | 0.67 |
| PF13683 | rve_3 | 0.67 |
| PF13508 | Acetyltransf_7 | 0.67 |
| PF10008 | DUF2251 | 0.67 |
| PF00893 | Multi_Drug_Res | 0.67 |
| PF02452 | PemK_toxin | 0.67 |
| PF14337 | Abi_alpha | 0.67 |
| PF01381 | HTH_3 | 0.67 |
| PF13715 | CarbopepD_reg_2 | 0.67 |
| PF13414 | TPR_11 | 0.67 |
| PF08867 | FRG | 0.67 |
| PF06271 | RDD | 0.67 |
| PF01609 | DDE_Tnp_1 | 0.67 |
| PF13302 | Acetyltransf_3 | 0.67 |
| PF09346 | SMI1_KNR4 | 0.67 |
| PF00488 | MutS_V | 0.67 |
| PF11751 | PorP_SprF | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.67 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.67 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 2.00 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 2.00 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 1.33 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 1.33 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.67 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.67 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 0.67 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.67 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.67 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.67 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 0.67 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.67 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.45 % |
| Unclassified | root | N/A | 8.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000558|Draft_10095829 | Not Available | 2274 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108584569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 768 | Open in IMG/M |
| 3300002703|draft_10992356 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1032 | Open in IMG/M |
| 3300002837|bg3kmer60_1065381 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Breznakibacter → Breznakibacter xylanolyticus | 776 | Open in IMG/M |
| 3300002837|bg3kmer60_1110796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Flexilinea → Flexilinea flocculi | 508 | Open in IMG/M |
| 3300004241|Ga0066604_10241255 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chlorobium/Pelodictyon group → Chlorobium → Chlorobium limicola | 722 | Open in IMG/M |
| 3300004242|Ga0066601_10186062 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 786 | Open in IMG/M |
| 3300005665|Ga0074127_101213 | All Organisms → cellular organisms → Bacteria | 5971 | Open in IMG/M |
| 3300006092|Ga0082021_1040189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Thalassobius → unclassified Thalassobius → Thalassobius sp. | 1313 | Open in IMG/M |
| 3300006594|Ga0079073_1276177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 552 | Open in IMG/M |
| 3300006838|Ga0101938_1015158 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300007051|Ga0102624_116140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 855 | Open in IMG/M |
| 3300007051|Ga0102624_123706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 665 | Open in IMG/M |
| 3300009081|Ga0105098_10832858 | Not Available | 501 | Open in IMG/M |
| 3300009095|Ga0079224_101249119 | Not Available | 1057 | Open in IMG/M |
| 3300009305|Ga0116592_1147619 | Not Available | 521 | Open in IMG/M |
| 3300009652|Ga0123330_1122475 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. 4G9 | 977 | Open in IMG/M |
| 3300009669|Ga0116148_1163703 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300009671|Ga0123334_1368063 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 609 | Open in IMG/M |
| 3300009673|Ga0116185_1008773 | All Organisms → cellular organisms → Bacteria | 7159 | Open in IMG/M |
| 3300009675|Ga0116149_1148680 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Paludibacteraceae → Paludibacter → Paludibacter jiangxiensis | 1132 | Open in IMG/M |
| 3300009675|Ga0116149_1257801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 768 | Open in IMG/M |
| 3300009680|Ga0123335_1110563 | Not Available | 1578 | Open in IMG/M |
| 3300009681|Ga0116174_10538006 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 529 | Open in IMG/M |
| 3300009685|Ga0116142_10151967 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Pontibacter → Pontibacter korlensis | 1213 | Open in IMG/M |
| 3300009690|Ga0116143_10040724 | All Organisms → cellular organisms → Bacteria | 2981 | Open in IMG/M |
| 3300009692|Ga0116171_10149383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1359 | Open in IMG/M |
| 3300009693|Ga0116141_10042195 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides stercorirosoris | 3056 | Open in IMG/M |
| 3300009693|Ga0116141_10110013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1632 | Open in IMG/M |
| 3300009693|Ga0116141_10315490 | Not Available | 822 | Open in IMG/M |
| 3300009694|Ga0116170_10068676 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
| 3300009694|Ga0116170_10165160 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1335 | Open in IMG/M |
| 3300009694|Ga0116170_10469647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 679 | Open in IMG/M |
| 3300009696|Ga0116177_10218433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1042 | Open in IMG/M |
| 3300009696|Ga0116177_10658131 | Not Available | 543 | Open in IMG/M |
| 3300009696|Ga0116177_10691732 | Not Available | 528 | Open in IMG/M |
| 3300009713|Ga0116163_1082561 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1261 | Open in IMG/M |
| 3300009713|Ga0116163_1092938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1168 | Open in IMG/M |
| 3300009771|Ga0116155_10072039 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300009771|Ga0116155_10159138 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 968 | Open in IMG/M |
| 3300009771|Ga0116155_10277749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 687 | Open in IMG/M |
| 3300009771|Ga0116155_10302385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 652 | Open in IMG/M |
| 3300009771|Ga0116155_10369076 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 579 | Open in IMG/M |
| 3300009771|Ga0116155_10467420 | All Organisms → cellular organisms → Bacteria → Caldiserica/Cryosericota group → Caldiserica → Caldisericia → Caldisericales → unclassified Caldisericales → Caldisericales bacterium | 503 | Open in IMG/M |
| 3300009772|Ga0116162_10246785 | Not Available | 750 | Open in IMG/M |
| 3300009775|Ga0116164_10078781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1612 | Open in IMG/M |
| 3300009775|Ga0116164_10123152 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1215 | Open in IMG/M |
| 3300009776|Ga0116154_10015615 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4067 | Open in IMG/M |
| 3300009776|Ga0116154_10223748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 818 | Open in IMG/M |
| 3300009778|Ga0116151_10341932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 694 | Open in IMG/M |
| 3300009779|Ga0116152_10043966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 2858 | Open in IMG/M |
| 3300009779|Ga0116152_10179898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1110 | Open in IMG/M |
| 3300009779|Ga0116152_10323057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 741 | Open in IMG/M |
| 3300009781|Ga0116178_10176837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1099 | Open in IMG/M |
| 3300009781|Ga0116178_10429822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 644 | Open in IMG/M |
| 3300009783|Ga0116158_10116261 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides stercorirosoris | 1679 | Open in IMG/M |
| 3300009783|Ga0116158_10267139 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 967 | Open in IMG/M |
| 3300009838|Ga0116153_10213512 | Not Available | 794 | Open in IMG/M |
| 3300009838|Ga0116153_10261319 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 709 | Open in IMG/M |
| 3300009870|Ga0131092_11348583 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 552 | Open in IMG/M |
| 3300010342|Ga0116252_10239023 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1106 | Open in IMG/M |
| 3300010345|Ga0116253_10014920 | All Organisms → cellular organisms → Bacteria | 7944 | Open in IMG/M |
| 3300010346|Ga0116239_10823092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 582 | Open in IMG/M |
| 3300010349|Ga0116240_10172560 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
| 3300010349|Ga0116240_10275458 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1170 | Open in IMG/M |
| 3300010349|Ga0116240_10881285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 574 | Open in IMG/M |
| 3300010350|Ga0116244_10079827 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
| 3300010350|Ga0116244_10160403 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales | 1624 | Open in IMG/M |
| 3300010350|Ga0116244_10535258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 770 | Open in IMG/M |
| 3300010352|Ga0116247_10403999 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 1068 | Open in IMG/M |
| 3300010353|Ga0116236_10277034 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Adhaeribacter | 1475 | Open in IMG/M |
| 3300010353|Ga0116236_10411913 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1148 | Open in IMG/M |
| 3300010355|Ga0116242_10152961 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2361 | Open in IMG/M |
| 3300010355|Ga0116242_10570121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1024 | Open in IMG/M |
| 3300010355|Ga0116242_11696374 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 509 | Open in IMG/M |
| 3300010357|Ga0116249_10072998 | All Organisms → cellular organisms → Bacteria | 3294 | Open in IMG/M |
| 3300010357|Ga0116249_10880118 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 813 | Open in IMG/M |
| 3300010357|Ga0116249_11111015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 712 | Open in IMG/M |
| 3300010357|Ga0116249_11173880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 690 | Open in IMG/M |
| 3300010357|Ga0116249_11258090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 663 | Open in IMG/M |
| 3300010357|Ga0116249_11709725 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 555 | Open in IMG/M |
| 3300010429|Ga0116241_10416106 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300010429|Ga0116241_10740656 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 756 | Open in IMG/M |
| 3300014833|Ga0119870_1103097 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 866 | Open in IMG/M |
| 3300014833|Ga0119870_1227327 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 528 | Open in IMG/M |
| 3300020814|Ga0214088_1639260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2354 | Open in IMG/M |
| 3300020814|Ga0214088_1806718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1693 | Open in IMG/M |
| 3300020814|Ga0214088_1927007 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300021603|Ga0226659_10079730 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1758 | Open in IMG/M |
| 3300021603|Ga0226659_10338033 | Not Available | 668 | Open in IMG/M |
| 3300023203|Ga0255812_10937986 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1063 | Open in IMG/M |
| 3300023203|Ga0255812_10937986 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1063 | Open in IMG/M |
| 3300023207|Ga0255811_10639098 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300023207|Ga0255811_10829159 | All Organisms → cellular organisms → Bacteria | 3409 | Open in IMG/M |
| 3300023207|Ga0255811_11222800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1671 | Open in IMG/M |
| 3300023207|Ga0255811_11475437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 585 | Open in IMG/M |
| 3300025611|Ga0209408_1073356 | Not Available | 943 | Open in IMG/M |
| 3300025702|Ga0209203_1156601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 710 | Open in IMG/M |
| 3300025706|Ga0209507_1007224 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5655 | Open in IMG/M |
| 3300025715|Ga0209310_1030880 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300025715|Ga0209310_1101737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 881 | Open in IMG/M |
| 3300025715|Ga0209310_1129154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 754 | Open in IMG/M |
| 3300025715|Ga0209310_1153740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 673 | Open in IMG/M |
| 3300025724|Ga0208196_1022123 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 3042 | Open in IMG/M |
| 3300025730|Ga0209606_1149610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 808 | Open in IMG/M |
| 3300025784|Ga0209200_1015212 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales | 4410 | Open in IMG/M |
| 3300025856|Ga0209604_1068720 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1673 | Open in IMG/M |
| 3300025856|Ga0209604_1289933 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300025858|Ga0209099_1017863 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4134 | Open in IMG/M |
| 3300025861|Ga0209605_1109290 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Pontibacter → Pontibacter korlensis | 1110 | Open in IMG/M |
| 3300025877|Ga0208460_10146686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 942 | Open in IMG/M |
| 3300025877|Ga0208460_10290553 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 608 | Open in IMG/M |
| 3300025902|Ga0209202_1032015 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2099 | Open in IMG/M |
| 3300025902|Ga0209202_1053659 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1466 | Open in IMG/M |
| 3300025902|Ga0209202_1130051 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 772 | Open in IMG/M |
| 3300025902|Ga0209202_1163977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 653 | Open in IMG/M |
| 3300025902|Ga0209202_1237327 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. 4G9 | 501 | Open in IMG/M |
| 3300027719|Ga0209467_1009974 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4873 | Open in IMG/M |
| 3300027719|Ga0209467_1173204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 765 | Open in IMG/M |
| 3300027739|Ga0209575_10004579 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 4815 | Open in IMG/M |
| 3300027739|Ga0209575_10086884 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1140 | Open in IMG/M |
| 3300027739|Ga0209575_10187462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 736 | Open in IMG/M |
| 3300027739|Ga0209575_10225591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 659 | Open in IMG/M |
| 3300027796|Ga0209373_10038491 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 2510 | Open in IMG/M |
| 3300027800|Ga0209800_10009950 | All Organisms → cellular organisms → Bacteria | 5677 | Open in IMG/M |
| 3300027800|Ga0209800_10257585 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 744 | Open in IMG/M |
| 3300027841|Ga0209262_10045641 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1956 | Open in IMG/M |
| 3300027841|Ga0209262_10308026 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. 4G9 | 771 | Open in IMG/M |
| 3300028624|Ga0302246_1060111 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 904 | Open in IMG/M |
| 3300028629|Ga0302248_1076865 | Not Available | 722 | Open in IMG/M |
| 3300028633|Ga0302236_1012504 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3330 | Open in IMG/M |
| 3300028635|Ga0302245_1087842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 676 | Open in IMG/M |
| 3300028641|Ga0302239_1023559 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300028851|Ga0307347_126435 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Breznakibacter → Breznakibacter xylanolyticus | 652 | Open in IMG/M |
| 3300029449|Ga0243128_1118182 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 672 | Open in IMG/M |
| 3300029797|Ga0243129_1010465 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3849 | Open in IMG/M |
| 3300029797|Ga0243129_1067001 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Muricauda → Muricauda ochracea | 1181 | Open in IMG/M |
| 3300029797|Ga0243129_1122201 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 739 | Open in IMG/M |
| 3300029797|Ga0243129_1146403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 640 | Open in IMG/M |
| 3300029799|Ga0311022_10290111 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 6902 | Open in IMG/M |
| 3300029799|Ga0311022_11394372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1584 | Open in IMG/M |
| 3300029799|Ga0311022_11394372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1584 | Open in IMG/M |
| 3300029799|Ga0311022_12099414 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter | 933 | Open in IMG/M |
| 3300029799|Ga0311022_12236106 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 810 | Open in IMG/M |
| 3300029799|Ga0311022_12748125 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Psychroserpens → unclassified Psychroserpens → Psychroserpens sp. MSW6 | 1205 | Open in IMG/M |
| 3300029799|Ga0311022_13163534 | All Organisms → cellular organisms → Bacteria → Caldiserica/Cryosericota group → Caldiserica → Caldisericia → Caldisericales → unclassified Caldisericales → Caldisericales bacterium | 1039 | Open in IMG/M |
| 3300029799|Ga0311022_13780404 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 701 | Open in IMG/M |
| 3300029799|Ga0311022_13787556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 882 | Open in IMG/M |
| 3300029799|Ga0311022_14194438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1210 | Open in IMG/M |
| 3300029799|Ga0311022_14721034 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300029825|Ga0134835_1070115 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 838 | Open in IMG/M |
| 3300029834|Ga0307324_109653 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 820 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 57.24% |
| Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 11.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 8.55% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Unclassified → Sediment | 3.29% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 3.29% |
| Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 3.29% |
| Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment | 1.97% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 1.97% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.32% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.32% |
| Biogas Reactor | Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor | 1.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.66% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.66% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.66% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.66% |
| Wastewater Treatment Plant | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant | 0.66% |
| Sediment | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Sediment | 0.66% |
| Fermentation Pit Mud | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002703 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5 | Engineered | Open in IMG/M |
| 3300002837 | Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer | Engineered | Open in IMG/M |
| 3300004241 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 | Environmental | Open in IMG/M |
| 3300004242 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 | Environmental | Open in IMG/M |
| 3300005665 | Alkane-degrading methanogenic microbial communities from enrichment of sediment from a hydrocarbon-contaminated ditch in Bremen, Germany | Engineered | Open in IMG/M |
| 3300006092 | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore | Engineered | Open in IMG/M |
| 3300006594 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Ile_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006838 | Combined Assembly of Gp0125106, Gp0125107, Gp0125108 | Environmental | Open in IMG/M |
| 3300007051 | Combined Assembly of 100bp T18 (BES) Gp0123708, Gp0123962, Gp0123963 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009305 | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_686d_2 SPAdes | Environmental | Open in IMG/M |
| 3300009652 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009671 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009673 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG | Engineered | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
| 3300009692 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009694 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG | Engineered | Open in IMG/M |
| 3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
| 3300009713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG | Engineered | Open in IMG/M |
| 3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
| 3300009772 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaG | Engineered | Open in IMG/M |
| 3300009775 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG | Engineered | Open in IMG/M |
| 3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
| 3300009778 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG | Engineered | Open in IMG/M |
| 3300009779 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC119_MetaG | Engineered | Open in IMG/M |
| 3300009781 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG | Engineered | Open in IMG/M |
| 3300009783 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG | Engineered | Open in IMG/M |
| 3300009838 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG | Engineered | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010342 | AD_JPNAca1 | Engineered | Open in IMG/M |
| 3300010345 | AD_JPNAca2 | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010349 | AD_HKTAca | Engineered | Open in IMG/M |
| 3300010350 | AD_HKSTca | Engineered | Open in IMG/M |
| 3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010355 | AD_USDVca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300014833 | Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - influent sewage | Engineered | Open in IMG/M |
| 3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
| 3300021603 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spades | Engineered | Open in IMG/M |
| 3300023203 | Combined Assembly of Gp0238866, Gp0238878 | Engineered | Open in IMG/M |
| 3300023207 | Combined Assembly of Gp0238866, Gp0238878, Gp0238879 | Engineered | Open in IMG/M |
| 3300025611 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025702 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025706 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025724 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025730 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025856 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025858 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025861 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025877 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025902 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027719 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027796 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027800 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300028624 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Trp | Engineered | Open in IMG/M |
| 3300028629 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Leu | Engineered | Open in IMG/M |
| 3300028633 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Gly | Engineered | Open in IMG/M |
| 3300028635 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Thr | Engineered | Open in IMG/M |
| 3300028641 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Glu | Engineered | Open in IMG/M |
| 3300028851 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Lys2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029449 | Sediment microbial communities from Yellow Sea, Weihai, China - HGD.1 | Environmental | Open in IMG/M |
| 3300029797 | Sediment microbial communities from Yellow Sea, Weihai, China - HGD.2 | Environmental | Open in IMG/M |
| 3300029799 | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 | Engineered | Open in IMG/M |
| 3300029825 | Liquor fermentation pit mud microbial communities from Luzhou, China - Meta-1-2-440-M | Engineered | Open in IMG/M |
| 3300029834 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Gly1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_100958294 | 3300000558 | Hydrocarbon Resource Environments | MQLASAPRESSGQNEKSLMAVQAAPAXAGDPLXVSRFLPTRE* |
| JGIcombinedJ13530_1085845692 | 3300001213 | Wetland | TGRYMQLASAPRESSGQNERPLMAVQAAPAPAGDPLKVSRFLLTRQ* |
| draft_109923561 | 3300002703 | Hydrocarbon Resource Environments | MQLASAPRESSGQNGRASMAVQAAPAPAGDSLLVSRFLPTRELSNNRITLH |
| bg3kmer60_10653811 | 3300002837 | Biogas Reactor | MQLASAPRESSSQNERPSMAVQAAPAPAGDSRLVSRFLPTRE |
| bg3kmer60_11107963 | 3300002837 | Biogas Reactor | MQLASAPRESSGQNERPSMAVQAAPAPAGDSRLVSRFLPTRE |
| Ga0066604_102412551 | 3300004241 | Freshwater | MSLASVPRESSGQNGRPLMAAQAAPAPAGDPLLVSRFLPTR |
| Ga0066601_101860622 | 3300004242 | Freshwater | MLTGRYMQLASAPRQYCGQNEWPSMAVQAAPAAAGEPLLVSRFLPTRE* |
| Ga0074127_1012134 | 3300005665 | Sediment | MQLASAPREAYGQNERPSMAVQAAPAPAGDPLLVSRFLPTRE* |
| Ga0082021_10401893 | 3300006092 | Wastewater Treatment Plant | MQLASAPRETSGQNERPSMAVQAAPAAAGDSLLVSRFLPTR |
| Ga0079073_12761771 | 3300006594 | Anaerobic Digestor Sludge | TTGRYMQLASAPRESSGQNERASMAVQAAPAPAGVSLLVSRFLPTRE* |
| Ga0101938_10151581 | 3300006838 | Sediment | MSLASAPRQYCGQNVRTSMAVQAAPAPAGDSLLVS |
| Ga0102624_1161403 | 3300007051 | Sediment | HLTGRYMQLASAPRESSGQNERPSMAVQAAPAAAGDSLLVSRFLPTRE* |
| Ga0102624_1237061 | 3300007051 | Sediment | MSLASVPRESSGQNERPLMAAQAAPAPAGDSLLVSRFLPTRE |
| Ga0105098_108328581 | 3300009081 | Freshwater Sediment | MSLASVPRESSGQNERPLMAAQAAPAPAGDSLWCHGF |
| Ga0079224_1012491194 | 3300009095 | Agricultural Soil | MSLASVPRESSSQNDRMLMAAQPAPAPAGDSLLVSRFLPT |
| Ga0116592_11476191 | 3300009305 | Sediment | MQLASAPRESSGQNERPSMAVQAAPAPAGDPLLVSRFLPTRELTN |
| Ga0123330_11224753 | 3300009652 | Anaerobic Biogas Reactor | MQLASAPRESSGQNERASMAVQAAPAPAGDSFLVSRFLPTREQTNQHHNPAS |
| Ga0116148_11637032 | 3300009669 | Anaerobic Digestor Sludge | MQLASAPREASGQNERASMAVQAAPAPAGDSLLVSRFLPTR |
| Ga0123334_13680631 | 3300009671 | Anaerobic Biogas Reactor | MSLASVPRESSGQNERPLMAAQAAPAAAGDSHWCHGF |
| Ga0116185_10087732 | 3300009673 | Anaerobic Digestor Sludge | MQLATAPRESSSQNEKPSMAAQAAPALAGDSLLVSRFLPTRE* |
| Ga0116149_11486801 | 3300009675 | Anaerobic Digestor Sludge | ASAPRESSGQNERPSMAVQAAPAPAGDSRLVSRFLPTRE* |
| Ga0116149_12578012 | 3300009675 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERPSMAVQAAPAPAGDSLLVSR |
| Ga0123335_11105633 | 3300009680 | Anaerobic Biogas Reactor | MQLASAPRASSGQNERPSMAVQAAPAPAGDPLLVSRFL |
| Ga0116174_105380061 | 3300009681 | Anaerobic Digestor Sludge | MQLASAPRESSGQNKRTSMAVQAAPALAGDPLVVS |
| Ga0116142_101519671 | 3300009685 | Anaerobic Digestor Sludge | LTGRYMSLASAPRESSGQNERASMAVQAAPAPAGDSLKVSRFLPTRE* |
| Ga0116143_100407247 | 3300009690 | Anaerobic Digestor Sludge | QLTGRYMSLASAPRESSGQNERASMAVQAAPAPAGDSLKVSRFLPTRE* |
| Ga0116171_101493832 | 3300009692 | Anaerobic Digestor Sludge | QLASAPRESSGQNERASMAVQAAPAPAGDSLLVSRFLPTRE* |
| Ga0116141_100421951 | 3300009693 | Anaerobic Digestor Sludge | MQLASAPREASGQNERPSMAVQAAPAPAGDPLLVSR |
| Ga0116141_101100131 | 3300009693 | Anaerobic Digestor Sludge | APRESSGQNERASMAVQAAPAPAGGSLLVSRFLPTRE* |
| Ga0116141_103154901 | 3300009693 | Anaerobic Digestor Sludge | LNKELVLTGRYMQLASAPREASGQNERPSMAVQAAPAPAGDPLLVSR |
| Ga0116170_100686761 | 3300009694 | Anaerobic Digestor Sludge | ITGRYMQLASAPRESSGQNERASMAVQAAPASAGDSLLVSRFLPTRE* |
| Ga0116170_101651601 | 3300009694 | Anaerobic Digestor Sludge | PRESSGQNKRTSMAVQAAPALAGDPLVVSRFLPTRE* |
| Ga0116170_104696471 | 3300009694 | Anaerobic Digestor Sludge | MQLASAPRESSGQHERPLMAVQAAPAPAGDSLLVSR |
| Ga0116177_102184331 | 3300009696 | Anaerobic Digestor Sludge | MSLASVPREFSGQNERSLMAAQAAPALAGDPLVVSRFLPTRELSNNHHNPA |
| Ga0116177_106581311 | 3300009696 | Anaerobic Digestor Sludge | MSLASVPRESSSQNDRMLMAAQAAPAPAGDSPLVSRFLPT |
| Ga0116177_106917323 | 3300009696 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERPSMAVQAAPAPAGDSLLVSRFLPTR |
| Ga0116163_10825611 | 3300009713 | Anaerobic Digestor Sludge | MSLASVPRESSGQNEGLLMAAQAAPAPAGDSLLVSR |
| Ga0116163_10929381 | 3300009713 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERPSMAVQAAPAPAGDPLLVSR |
| Ga0116155_100720394 | 3300009771 | Anaerobic Digestor Sludge | MSLASVPRESSGQNERPLMAAQAAPAPAGDSLLVSRFLPTRELS |
| Ga0116155_101591381 | 3300009771 | Anaerobic Digestor Sludge | SKTARYLTGRYMQLASAPRESSGQNERPSMAVQAAPAPAGDSLLVSRFLPTRE* |
| Ga0116155_102777491 | 3300009771 | Anaerobic Digestor Sludge | MQLASAPRESSGQNEIASMAVQAAPAPAGDSLLVSR |
| Ga0116155_103023853 | 3300009771 | Anaerobic Digestor Sludge | MSLASVPREFSGQNERPLMAAQAAPAPAGDSLLVS |
| Ga0116155_103690762 | 3300009771 | Anaerobic Digestor Sludge | MSLASAPRESFGQNERPLMAVQAAPAPAGASLLVS |
| Ga0116155_104674201 | 3300009771 | Anaerobic Digestor Sludge | MSLASVPRESSGQNERPLMAAQAAPAPAGDPLLVSRFLPTR |
| Ga0116162_102467852 | 3300009772 | Anaerobic Digestor Sludge | MQLASAPRESSDQNDRQFMAVQAAPALAGDSLLVSRFLP |
| Ga0116164_100787811 | 3300009775 | Anaerobic Digestor Sludge | MQLATAPRESSGQNERSSMAVQAAPAPAGDTLLVSRFLPTRE* |
| Ga0116164_101231522 | 3300009775 | Anaerobic Digestor Sludge | MSLASVPRESSGQNEGLLMAAQAAPAPAGDSLLVSRFLPTRE |
| Ga0116154_100156158 | 3300009776 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERLLMAVQATPAPAGDPLLVSRFLPTRQ* |
| Ga0116154_102237483 | 3300009776 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERSSMAVQAAPAPAGDPLLVSRFLPTRESGNYRI |
| Ga0116151_103419322 | 3300009778 | Anaerobic Digestor Sludge | LLLTGRYMQLASAPRESSGQNEGLTMAVQAAPAAAGDPLLVSRFLPTRE* |
| Ga0116152_100439662 | 3300009779 | Anaerobic Digestor Sludge | MSLASAPRESSGQNERPSMAVQPAPALAGDPLLVSWFLPTRE* |
| Ga0116152_101798981 | 3300009779 | Anaerobic Digestor Sludge | ASAPRESSGQNEIASMAVQAAPAPAGDPLLVSRFLPTRE* |
| Ga0116152_103230571 | 3300009779 | Anaerobic Digestor Sludge | TGRYMQLASAPRESSGQNERTSMAVQAAPAPAGDSLLVSRFLPTRQ* |
| Ga0116178_101768372 | 3300009781 | Anaerobic Digestor Sludge | MLTGRYMSLASVPREFSGQNERSLMAAQAAPALAGDPLVVSRFLPTRELSN |
| Ga0116178_104298221 | 3300009781 | Anaerobic Digestor Sludge | MQLASAPRKFSGQNERPSMAVQAAPAPAGDSLLVS |
| Ga0116158_101162613 | 3300009783 | Anaerobic Digestor Sludge | MQLASAPREASGQNERPSMAVQAAPAPAGDPLLVSRFL |
| Ga0116158_102671393 | 3300009783 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERPSMAVQAAPALAGDSLLVSRFLPTR |
| Ga0116153_102135121 | 3300009838 | Anaerobic Digestor Sludge | MSLASVPREFSDYRTVLWLAAQAAPAPAGDPLLVSR |
| Ga0116153_102613191 | 3300009838 | Anaerobic Digestor Sludge | MQLASAPREFSGQNERTIMAVQAAPAPAGDPLLVSRFL |
| Ga0131092_113485831 | 3300009870 | Activated Sludge | MQLASAPRESSGQNERASMAVQAAPAPAGDSLLVSRFLPTRE |
| Ga0116252_102390232 | 3300010342 | Anaerobic Digestor Sludge | QLASAPRESSGQNERPSMAVQAAPAPAGDSRLVSRFLPTRE* |
| Ga0116253_100149203 | 3300010345 | Anaerobic Digestor Sludge | MQLASAPREYSGQNEKPSMAVQAAPAPAGDSPLVSRFLPTRE* |
| Ga0116239_108230923 | 3300010346 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERTSMAVQAAPAAAGDSLLVSRFLPTRESTKLHHITASHHECK |
| Ga0116240_101725602 | 3300010349 | Anaerobic Digestor Sludge | MSLASVPRESAGQNERPLMAAQAAPAPAGDPLLVSRF |
| Ga0116240_102754582 | 3300010349 | Anaerobic Digestor Sludge | MSLASVPRESSGQNEGLLMAAQAAPAPAGDSLLVSRFLPTREQTNKHHNPASHHE |
| Ga0116240_108812852 | 3300010349 | Anaerobic Digestor Sludge | MSLASVPREFSDYRTVLWLAAQAAPAPAGDPLLVSRFLPTREQTN |
| Ga0116244_100798271 | 3300010350 | Anaerobic Digestor Sludge | MSLASVPRESSGQNEGLLMAAQAAPAPAGDSLLVSRFLPTRE* |
| Ga0116244_101604031 | 3300010350 | Anaerobic Digestor Sludge | MEEVQSTTGRYMQLASAPRESSGQNERPSMAVQAAPAPAGVPLLVSRF |
| Ga0116244_105352582 | 3300010350 | Anaerobic Digestor Sludge | SLASAPRESSGQNERASMAVQAAPAPAGDSLKVSRFLPTRE* |
| Ga0116247_104039992 | 3300010352 | Anaerobic Digestor Sludge | MQLASAPREYCGQLEKPSMAVQAAPAPAGGSLLVSRFL |
| Ga0116236_102770341 | 3300010353 | Anaerobic Digestor Sludge | ESSGQNERASMAVQAAPAPAGDSLKVSRFLPTRE* |
| Ga0116236_104119131 | 3300010353 | Anaerobic Digestor Sludge | MSLASVPRESSGQNERPLMAAQPAPAPAGDSLLVS |
| Ga0116242_101529611 | 3300010355 | Anaerobic Digestor Sludge | MQLASAPREASGQNERPSMAVQAAPAPAGDPLLVSRF |
| Ga0116242_105701211 | 3300010355 | Anaerobic Digestor Sludge | GGIGRIRKSKTARYLTGRYMQLASAPRESSGQNERTSMAVQAAPALAGDSLMVSRFLPTRE* |
| Ga0116242_116963742 | 3300010355 | Anaerobic Digestor Sludge | MQLASAPREYSGQNERPSMAVQAAPAPAGDSLLVSRF |
| Ga0116249_100729984 | 3300010357 | Anaerobic Digestor Sludge | LASAPRESSGQNERASMAVQAAPAPAGDSLLVSRFLPTRE* |
| Ga0116249_108801183 | 3300010357 | Anaerobic Digestor Sludge | MSLASVPRESSGQNVIPLMAAQAAPAPAGDSLLVSRFLPTR |
| Ga0116249_111110151 | 3300010357 | Anaerobic Digestor Sludge | MQLASAPRESSGQNEKPLTAVQAAPAPAGDSLLVSRFLPTRESTKQY |
| Ga0116249_111738802 | 3300010357 | Anaerobic Digestor Sludge | MRHDGTTGRYMQLASAPRESSGQNERTSMAVQAAPAAAGDSLLVSRFLPTRQLI |
| Ga0116249_112580901 | 3300010357 | Anaerobic Digestor Sludge | APREFSGQNEKTSMAVQAAPAPAGGSLLVSRFLPTRE* |
| Ga0116249_117097252 | 3300010357 | Anaerobic Digestor Sludge | MQLASAPREYCGRHEKPSMAVQAASAPAGVSLLVSRFL |
| Ga0116241_104161061 | 3300010429 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERHSMAVQATPAPAGDPLLVS |
| Ga0116241_107406562 | 3300010429 | Anaerobic Digestor Sludge | MQLASAPRESSGQNGRASMAVQAAPAPAGDSLLVSRFLPTRELSNNRITL |
| Ga0119870_11030972 | 3300014833 | Activated Sludge | MSLASVPRESSGQKERPLMAAQAAPAPAGDSLLVSRFLPTR |
| Ga0119870_12273271 | 3300014833 | Activated Sludge | MQLASAPRESSGQNERPSMAVQAAPAPAGGSLPGA |
| Ga0214088_16392601 | 3300020814 | Granular Sludge | KTARYLTGRYMQLASAPRESSGQNERPSMAVQAAPAPAGDSLLVSRFLPTRE |
| Ga0214088_18067182 | 3300020814 | Granular Sludge | MQLATAPRESSSQNEKPSMAAQAAPALAGDSLLVSRFLPTRE |
| Ga0214088_19270071 | 3300020814 | Granular Sludge | MQLASAPRESSGQNERTSMAVQAAPAPAGDSLLVSRFLPT |
| Ga0226659_100797302 | 3300021603 | Granular Sludge | MSLASVPRESSGQNERPLMAAQAAPAPAGDSLLVSRFLPTREQTNKHHNP |
| Ga0226659_103380331 | 3300021603 | Granular Sludge | MQLATAPRESSSQNEKPSMAAQAAPALAGDSLLVSRVL |
| Ga0255812_109379861 | 3300023203 | Anaerobic Digester Digestate | MSLASVPRESSGQKERPLMAAQAAPAPAGDSLLVSRFLP |
| Ga0255812_109379863 | 3300023203 | Anaerobic Digester Digestate | LRTLTGRYMSLASVPRESSGQKERPLMAAQAAPAPAGDSLLVSRFLPTRE |
| Ga0255811_106390981 | 3300023207 | Anaerobic Digester Digestate | IGRIEKSKRARYLTGRYMQLASAPREFSGQNERPSTAVQAAPARAGGSLVVSRFLPTRE |
| Ga0255811_108291591 | 3300023207 | Anaerobic Digester Digestate | IGRIEKSKRARYLTGRYMQLASAPREFSGQNERPSTAVQAAPARAGDSLVVSRFLPTR |
| Ga0255811_112228001 | 3300023207 | Anaerobic Digester Digestate | YMSLASVPRESSGQNERPLMAAQAAPAPAGDSLLVSRFLPTRE |
| Ga0255811_114754371 | 3300023207 | Anaerobic Digester Digestate | GRYMQLASAPRESSGQNERPSMAVQAAPAPAGDSLLVSRFLPTRE |
| Ga0209408_10733562 | 3300025611 | Anaerobic Digestor Sludge | MQLASAPRESSSQNERPSMAVQAAPAPAGDPLLVSRFLPTRE |
| Ga0209203_11566012 | 3300025702 | Anaerobic Digestor Sludge | MSLASVPREFSDYRTVLWLAAQAAPAPAGDPLLVSRFLPTRE |
| Ga0209507_10072242 | 3300025706 | Anaerobic Digestor Sludge | MQLASAPREFSGQNERTIMAVQAAPAPAGDPLLVSRFLPTRE |
| Ga0209310_10308801 | 3300025715 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERLLMAVQATPAPAGDPLLVSRFLPTRQ |
| Ga0209310_11017371 | 3300025715 | Anaerobic Digestor Sludge | MQLASAPRESSGQNEIASMAVQAAPAPAGDSLLVS |
| Ga0209310_11291541 | 3300025715 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERSSMAVQAAPAPAGDPLLVSRFLPTRES |
| Ga0209310_11537402 | 3300025715 | Anaerobic Digestor Sludge | MQLASAPRESSGQNEIASMAVQAAPAPAGDPLLVS |
| Ga0208196_10221231 | 3300025724 | Anaerobic Digestor Sludge | MQLASAPREYSGQNEKPSMAVQAAPAPAGDSPLVSRFLPTRE |
| Ga0209606_11496101 | 3300025730 | Anaerobic Digestor Sludge | MSLASAPRESSDQNGRASMAVQAAPAPAGDPLLVSRFLP |
| Ga0209200_10152121 | 3300025784 | Anaerobic Digestor Sludge | MSLASAPREPSGHNARPSMAVQAAPAPAGDPLLVSRFLPTRE |
| Ga0209604_10687201 | 3300025856 | Anaerobic Digestor Sludge | MSLASAPRESSGQNERASMAVQAAPAPAGDSLKVSRFL |
| Ga0209604_12899331 | 3300025856 | Anaerobic Digestor Sludge | MSLASAPRESSGQNERASMAVQAAPAPAGDSLLVSRFLPT |
| Ga0209099_10178635 | 3300025858 | Anaerobic Digestor Sludge | LQLTGRYMSLASAPRESSGQNERASMAVQAAPAPAGDSLKVSRFLPTRE |
| Ga0209605_11092901 | 3300025861 | Anaerobic Digestor Sludge | PRESSGQNERASMAVQAAPAPAGDSLKVSRFLPTRE |
| Ga0208460_101466862 | 3300025877 | Anaerobic Digestor Sludge | MLTGRYMSLASVPREFSGQNERPLMAAQAAPAPAGDSLLVSRF |
| Ga0208460_102905531 | 3300025877 | Anaerobic Digestor Sludge | MSLASVPRESSGQNERPLMAAQAAPAPAGDPLLVSRFLPTREQT |
| Ga0209202_10320151 | 3300025902 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERPSMAVQAAPAPAGDSLLVS |
| Ga0209202_10536591 | 3300025902 | Anaerobic Digestor Sludge | MSLASVPREFSGQNERPLMAAQAAPAPAGDSLLVSR |
| Ga0209202_11300513 | 3300025902 | Anaerobic Digestor Sludge | MSLASVPRETSGRNERPLMAAQAAPAPAGDSLLVSRF |
| Ga0209202_11639772 | 3300025902 | Anaerobic Digestor Sludge | MQLASAPRESSGQNERASMAVQAAPAPAGDPLLVSRFLPTREKTKQLH |
| Ga0209202_12373272 | 3300025902 | Anaerobic Digestor Sludge | MQLASAPRESSGQNDRLLMAVQAAPAAAGDSLLVTRFLPTRESTKQ |
| Ga0209467_10099741 | 3300027719 | Freshwater | MSLASVPRETYGRNARPLMAAQAAPAPAGDSLLVSRFLP |
| Ga0209467_11732041 | 3300027719 | Freshwater | MQLASAPRESSGQNERASMAVQAAPAPAGDSLLVSR |
| Ga0209575_100045795 | 3300027739 | Freshwater | MQLASAPREFSGQNERPSMAVQAAPARAGDSLVVSRFLPTRE |
| Ga0209575_100868843 | 3300027739 | Freshwater | MQLASAPRESSGQNGRASMAVQAAPAPAGDSLLVSRF |
| Ga0209575_101874622 | 3300027739 | Freshwater | MSLASVPREFSDYRTVLWLAAQAAPAPAGDPLLVSRFLPTREQT |
| Ga0209575_102255912 | 3300027739 | Freshwater | MSLASAPRESSGQNGRASMAVQAAPAPAGDPLLVSRFLP |
| Ga0209373_100384911 | 3300027796 | Freshwater | PRESSGQNERPSMAVQAAPAPAGDSLLVSRFLPTRE |
| Ga0209800_1000995012 | 3300027800 | Freshwater | MQLASAPRETSGQNERASLAVQAAPAPAGDSLLVSRFLPTRE |
| Ga0209800_102575851 | 3300027800 | Freshwater | MQLASAPREPSGQNVRSSMAVQAAPAPAGDSLLVSRFLPTRELSNN |
| Ga0209262_100456415 | 3300027841 | Freshwater | RYMQLASAPRESSGQNERPSMAVQAAPAPAGDPLLVSRFLPTRE |
| Ga0209262_103080262 | 3300027841 | Freshwater | MQLASAPRESSGQNDRLLMAVQAAPAAAGDSLLVT |
| Ga0302246_10601111 | 3300028624 | Activated Sludge | MSLASVPRESSGQNAIMLMAAQAAPAPAGDSLLVSRF |
| Ga0302248_10768652 | 3300028629 | Activated Sludge | MSLASVPRESSGQNAIMLMAAQAAPAPAGDSLLVSR |
| Ga0302236_10125041 | 3300028633 | Activated Sludge | MSLASVPRESSGQKERPLMAAQAAPAPAGDSLLVSRFLPTRE |
| Ga0302245_10878421 | 3300028635 | Activated Sludge | MQLASAPRESSGQNERPSMAVQAAPAPAGDSRWCH |
| Ga0302239_10235594 | 3300028641 | Activated Sludge | MQLASAPREYCGRHEKPSMAVQAAPAPAGGSLLVS |
| Ga0307347_1264351 | 3300028851 | Anaerobic Digestor Sludge | MQLASAPRESSSQNERPSMAVQAAPAPAGDSRLVSR |
| Ga0243128_11181821 | 3300029449 | Sediment | MSLASVPRESSGQNVIPLMAAQAAPAPAGDSLLVSRF |
| Ga0243129_10104651 | 3300029797 | Sediment | QLASAPRESSGQNERASMAVQAAPAPAGDSLLVSRFLPTRK |
| Ga0243129_10670011 | 3300029797 | Sediment | MQLASAPRESSGQNEIASMAVQAAPAPAGDSLLVSRFLPTR |
| Ga0243129_11222013 | 3300029797 | Sediment | MSLASVPRESSGQNVIPLMAAQAAPAPAGDSLLVSRFLPT |
| Ga0243129_11464031 | 3300029797 | Sediment | MSLASAPRQYCGQNVRTSMAVQAAPAPAGDPLLVSRFLPTREHTNQH |
| Ga0311022_102901111 | 3300029799 | Anaerobic Digester Digestate | MSLASVPRESSGQNERPLMAAQAAPAPAGDSLLVSRF |
| Ga0311022_113943721 | 3300029799 | Anaerobic Digester Digestate | MQLASAPRESSGQNERASMAVQAAPAPAGDSLLVSRF |
| Ga0311022_113943723 | 3300029799 | Anaerobic Digester Digestate | MQLASAPRESSGQNERPSMAVQAAPAPAGDPLLVSRFLPTRE |
| Ga0311022_120994142 | 3300029799 | Anaerobic Digester Digestate | MSLASVPRESSDQNERPLMAAQAAPAPAGDSLLVSRFLPTRE |
| Ga0311022_122361062 | 3300029799 | Anaerobic Digester Digestate | MQLASAPRETSGQHERPSIAVQAAPAPAGVSLLVSRFLPTRELTNNRIILHRTSS |
| Ga0311022_127481251 | 3300029799 | Anaerobic Digester Digestate | LTGRYMQLASAPRESSGQNERASMAVQAAPAPAGDSLLVSRFLPTRK |
| Ga0311022_131635341 | 3300029799 | Anaerobic Digester Digestate | LKRHLTGRYMSLASVPRESSGQNERPLMAAQAAPAPAGASLLVSRFLPTRE |
| Ga0311022_137804042 | 3300029799 | Anaerobic Digester Digestate | LASAPRESSGQNERPSMAVQAAPAPAGDSLLVSRFLPTRE |
| Ga0311022_137875561 | 3300029799 | Anaerobic Digester Digestate | MQLASAPRESSGQNERTSMAVQAAPAAAGDSLLVSRFLPTRE |
| Ga0311022_141944381 | 3300029799 | Anaerobic Digester Digestate | SGGIGRIRKSKTARYLTGRYMQLASAPREASGQNESASMAAQAAPALGGDPHLVSRFLPTRE |
| Ga0311022_147210345 | 3300029799 | Anaerobic Digester Digestate | MQLASAPRESSGQNERPLMAVQAAPAPAGVPLVVSRFLPTRV |
| Ga0134835_10701153 | 3300029825 | Fermentation Pit Mud | MQLASAPREPSGQNVRSSMAVQAAPAPAGDSLLVSRFLPT |
| Ga0307324_1096531 | 3300029834 | Anaerobic Digestor Sludge | MQLASAPREYSGRNENPSMAVQAAPAPAGDSLLVSRFLPTRE |
| ⦗Top⦘ |