| Basic Information | |
|---|---|
| Family ID | F037234 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MNKYLKLDPKPSDLTTVRIIKVRTGYRCKDIRRTVVS |
| Number of Associated Samples | 158 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 1.82 % |
| % of genes near scaffold ends (potentially truncated) | 85.12 % |
| % of genes from short scaffolds (< 2000 bps) | 86.31 % |
| Associated GOLD sequencing projects | 154 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (50.595 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.095 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.214 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.38% β-sheet: 0.00% Coil/Unstructured: 64.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF00510 | COX3 | 1.79 |
| PF13302 | Acetyltransf_3 | 0.60 |
| PF00499 | Oxidored_q3 | 0.60 |
| PF07453 | NUMOD1 | 0.60 |
| PF00722 | Glyco_hydro_16 | 0.60 |
| PF00940 | RNA_pol | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 1.79 |
| COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 0.60 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.60 |
| COG5108 | Mitochondrial DNA-directed RNA polymerase | Transcription [K] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.79 % |
| Unclassified | root | N/A | 48.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000305|bgg_mtDRAFT_1023051 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1614 | Open in IMG/M |
| 3300000305|bgg_mtDRAFT_1030998 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 2409 | Open in IMG/M |
| 3300000305|bgg_mtDRAFT_1030999 | Not Available | 862 | Open in IMG/M |
| 3300001161|JGI12135J13285_100153 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 4617 | Open in IMG/M |
| 3300001169|JGI12661J13543_100109 | Not Available | 2278 | Open in IMG/M |
| 3300001305|C688J14111_10111087 | Not Available | 837 | Open in IMG/M |
| 3300001593|JGI12635J15846_10049290 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 3224 | Open in IMG/M |
| 3300001593|JGI12635J15846_10195911 | Not Available | 1340 | Open in IMG/M |
| 3300001867|JGI12627J18819_10007466 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 4228 | Open in IMG/M |
| 3300001989|JGI24739J22299_10013909 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 2932 | Open in IMG/M |
| 3300002018|BBAY61_100123 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1078 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101135196 | Not Available | 669 | Open in IMG/M |
| 3300002677|Ga0005475J37263_104644 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5 | 911 | Open in IMG/M |
| 3300003328|Ga0006576J49610_1004010 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 896 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10281052 | Not Available | 677 | Open in IMG/M |
| 3300003571|Ga0007419J51692_1027136 | Not Available | 929 | Open in IMG/M |
| 3300003735|Ga0006780_1054622 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 544 | Open in IMG/M |
| 3300004967|Ga0072330_1196738 | Not Available | 506 | Open in IMG/M |
| 3300004971|Ga0072324_1027011 | Not Available | 923 | Open in IMG/M |
| 3300005175|Ga0066673_10432042 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 772 | Open in IMG/M |
| 3300005344|Ga0070661_100827950 | Not Available | 761 | Open in IMG/M |
| 3300005556|Ga0066707_11024748 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 503 | Open in IMG/M |
| 3300005616|Ga0068852_100824586 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea | 942 | Open in IMG/M |
| 3300005640|Ga0075035_1111943 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 816 | Open in IMG/M |
| 3300005644|Ga0075036_1041207 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 655 | Open in IMG/M |
| 3300005646|Ga0075040_1006287 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 931 | Open in IMG/M |
| 3300005718|Ga0068866_10753755 | Not Available | 673 | Open in IMG/M |
| 3300005944|Ga0066788_10001399 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 4626 | Open in IMG/M |
| 3300005994|Ga0066789_10226183 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 786 | Open in IMG/M |
| 3300005995|Ga0066790_10040443 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 2026 | Open in IMG/M |
| 3300006020|Ga0058704_10188436 | Not Available | 1147 | Open in IMG/M |
| 3300006028|Ga0070717_10519105 | Not Available | 1077 | Open in IMG/M |
| 3300006403|Ga0075514_1928493 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 918 | Open in IMG/M |
| 3300006423|Ga0075039_1101837 | Not Available | 725 | Open in IMG/M |
| 3300006423|Ga0075039_1103668 | Not Available | 733 | Open in IMG/M |
| 3300006426|Ga0075037_1178873 | Not Available | 729 | Open in IMG/M |
| 3300006696|Ga0031674_1171128 | Not Available | 575 | Open in IMG/M |
| 3300006703|Ga0005508_1202264 | Not Available | 597 | Open in IMG/M |
| 3300006893|Ga0073928_10303997 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis | 1197 | Open in IMG/M |
| 3300006948|Ga0099826_10503635 | All Organisms → cellular organisms → Eukaryota | 565 | Open in IMG/M |
| 3300009247|Ga0103861_10069064 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 571 | Open in IMG/M |
| 3300009249|Ga0103862_1043216 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 623 | Open in IMG/M |
| 3300009254|Ga0103867_1027382 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 598 | Open in IMG/M |
| 3300009325|Ga0116603_104711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae | 3798 | Open in IMG/M |
| 3300009352|Ga0103865_1008935 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 585 | Open in IMG/M |
| 3300009635|Ga0116117_1072756 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 850 | Open in IMG/M |
| 3300010039|Ga0126309_10955403 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea | 572 | Open in IMG/M |
| 3300010061|Ga0127462_164764 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 1605 | Open in IMG/M |
| 3300010063|Ga0127431_102272 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 1158 | Open in IMG/M |
| 3300010069|Ga0127467_147767 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 769 | Open in IMG/M |
| 3300010106|Ga0127472_1052062 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 894 | Open in IMG/M |
| 3300010110|Ga0126316_1032205 | Not Available | 843 | Open in IMG/M |
| 3300010139|Ga0127464_1217502 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 997 | Open in IMG/M |
| 3300010146|Ga0126320_1159835 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1314 | Open in IMG/M |
| 3300010337|Ga0134062_10522672 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 600 | Open in IMG/M |
| 3300010854|Ga0126360_1096855 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1007 | Open in IMG/M |
| 3300010856|Ga0126358_1100207 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 519 | Open in IMG/M |
| 3300010864|Ga0126357_1309567 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 843 | Open in IMG/M |
| 3300010867|Ga0126347_1205090 | Not Available | 522 | Open in IMG/M |
| 3300010872|Ga0136897_11085562 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 535 | Open in IMG/M |
| 3300011023|Ga0138548_101815 | Not Available | 686 | Open in IMG/M |
| 3300011120|Ga0150983_13233306 | Not Available | 606 | Open in IMG/M |
| 3300011332|Ga0126317_10495731 | Not Available | 1189 | Open in IMG/M |
| 3300011332|Ga0126317_11019724 | Not Available | 950 | Open in IMG/M |
| 3300012068|Ga0153989_1017860 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 914 | Open in IMG/M |
| 3300012099|Ga0153957_102268 | Not Available | 1601 | Open in IMG/M |
| 3300012212|Ga0150985_114700225 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1329 | Open in IMG/M |
| 3300012359|Ga0137385_10687231 | Not Available | 855 | Open in IMG/M |
| 3300012364|Ga0134027_1022262 | Not Available | 518 | Open in IMG/M |
| 3300012372|Ga0134037_1107207 | Not Available | 1010 | Open in IMG/M |
| 3300012374|Ga0134039_1241936 | Not Available | 584 | Open in IMG/M |
| 3300012375|Ga0134034_1231555 | Not Available | 1154 | Open in IMG/M |
| 3300012406|Ga0134053_1433193 | Not Available | 1189 | Open in IMG/M |
| 3300012727|Ga0157531_1030172 | Not Available | 615 | Open in IMG/M |
| 3300012754|Ga0138278_1053181 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1965 | Open in IMG/M |
| 3300012781|Ga0138286_1147355 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2481 | Open in IMG/M |
| 3300012894|Ga0160427_10130044 | Not Available | 1064 | Open in IMG/M |
| 3300013295|Ga0170791_16318122 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1590 | Open in IMG/M |
| 3300013312|Ga0173631_1126740 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 503 | Open in IMG/M |
| 3300017417|Ga0182230_1038627 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea | 836 | Open in IMG/M |
| 3300017440|Ga0182214_1080350 | Not Available | 679 | Open in IMG/M |
| 3300018432|Ga0190275_11783740 | Not Available | 694 | Open in IMG/M |
| 3300018504|Ga0193465_100003 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 3700 | Open in IMG/M |
| 3300019212|Ga0180106_1214792 | Not Available | 1020 | Open in IMG/M |
| 3300019242|Ga0181502_1271560 | Not Available | 703 | Open in IMG/M |
| 3300019254|Ga0184641_1102189 | Not Available | 713 | Open in IMG/M |
| 3300019263|Ga0184647_1257922 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5 | 683 | Open in IMG/M |
| 3300019279|Ga0184642_1255535 | All Organisms → cellular organisms → Eukaryota | 3383 | Open in IMG/M |
| 3300020068|Ga0184649_1101668 | Not Available | 830 | Open in IMG/M |
| 3300021088|Ga0210404_10016919 | All Organisms → cellular organisms → Eukaryota | 3075 | Open in IMG/M |
| 3300021333|Ga0210324_1106219 | Not Available | 1303 | Open in IMG/M |
| 3300021342|Ga0206691_1466811 | Not Available | 626 | Open in IMG/M |
| 3300021401|Ga0210393_10532756 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 959 | Open in IMG/M |
| 3300021403|Ga0210397_10405186 | All Organisms → cellular organisms → Eukaryota | 1020 | Open in IMG/M |
| 3300021858|Ga0213852_1008705 | Not Available | 724 | Open in IMG/M |
| 3300021860|Ga0213851_1310335 | Not Available | 641 | Open in IMG/M |
| 3300022467|Ga0224712_10105768 | Not Available | 1200 | Open in IMG/M |
| 3300022530|Ga0242658_1080216 | Not Available | 749 | Open in IMG/M |
| 3300022530|Ga0242658_1120008 | Not Available | 650 | Open in IMG/M |
| 3300022533|Ga0242662_10061119 | Not Available | 998 | Open in IMG/M |
| 3300023259|Ga0224551_1055177 | Not Available | 692 | Open in IMG/M |
| 3300023708|Ga0228709_1003885 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 3126 | Open in IMG/M |
| 3300025914|Ga0207671_10365178 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea | 1146 | Open in IMG/M |
| 3300026118|Ga0207675_101385093 | Not Available | 724 | Open in IMG/M |
| 3300026215|Ga0209849_1001240 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 4584 | Open in IMG/M |
| 3300026316|Ga0209155_1179388 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 685 | Open in IMG/M |
| 3300026911|Ga0209620_1001699 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1563 | Open in IMG/M |
| 3300027176|Ga0208992_1001321 | Not Available | 2469 | Open in IMG/M |
| 3300027303|Ga0208999_1003658 | Not Available | 1617 | Open in IMG/M |
| 3300027766|Ga0209796_10276426 | Not Available | 538 | Open in IMG/M |
| 3300028019|Ga0224573_1003584 | All Organisms → Viruses → Predicted Viral | 1146 | Open in IMG/M |
| 3300028181|Ga0256909_1076871 | Not Available | 728 | Open in IMG/M |
| 3300028452|Ga0307247_10075108 | Not Available | 1034 | Open in IMG/M |
| 3300029919|Ga0302141_1107610 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 753 | Open in IMG/M |
| 3300029998|Ga0302271_10378492 | Not Available | 614 | Open in IMG/M |
| 3300030501|Ga0268244_10084903 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1396 | Open in IMG/M |
| 3300030501|Ga0268244_10523183 | Not Available | 638 | Open in IMG/M |
| 3300030563|Ga0247653_1007135 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 849 | Open in IMG/M |
| 3300030576|Ga0247644_1076559 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis | 695 | Open in IMG/M |
| 3300030592|Ga0247612_1204150 | Not Available | 512 | Open in IMG/M |
| 3300030614|Ga0247657_10037492 | Not Available | 849 | Open in IMG/M |
| 3300030758|Ga0138305_1558065 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 540 | Open in IMG/M |
| 3300030799|Ga0074010_10175691 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1216 | Open in IMG/M |
| 3300030817|Ga0315864_113527 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea | 643 | Open in IMG/M |
| 3300030860|Ga0074000_10080843 | Not Available | 676 | Open in IMG/M |
| 3300030875|Ga0265727_101841 | Not Available | 653 | Open in IMG/M |
| 3300030890|Ga0315875_126256 | Not Available | 602 | Open in IMG/M |
| 3300030908|Ga0074005_10180947 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 583 | Open in IMG/M |
| 3300030920|Ga0102762_1045502 | Not Available | 504 | Open in IMG/M |
| 3300030938|Ga0138299_10996883 | Not Available | 776 | Open in IMG/M |
| 3300030979|Ga0068589_11777034 | Not Available | 648 | Open in IMG/M |
| 3300030983|Ga0315886_118079 | Not Available | 517 | Open in IMG/M |
| 3300030993|Ga0308190_1202518 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 500 | Open in IMG/M |
| 3300031009|Ga0074022_1079493 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 587 | Open in IMG/M |
| 3300031009|Ga0074022_1126476 | Not Available | 703 | Open in IMG/M |
| 3300031048|Ga0074025_1328185 | Not Available | 953 | Open in IMG/M |
| 3300031057|Ga0170834_112983294 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella → Morchella sect. Distantes → Morchella brunnea | 873 | Open in IMG/M |
| 3300031061|Ga0315844_114004 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 562 | Open in IMG/M |
| 3300031065|Ga0315807_113033 | Not Available | 582 | Open in IMG/M |
| 3300031073|Ga0315818_122452 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 633 | Open in IMG/M |
| 3300031081|Ga0308185_1007977 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1081 | Open in IMG/M |
| 3300031092|Ga0308204_10005382 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2025 | Open in IMG/M |
| 3300031096|Ga0308193_1007445 | Not Available | 1196 | Open in IMG/M |
| 3300031122|Ga0170822_10836304 | Not Available | 604 | Open in IMG/M |
| 3300031122|Ga0170822_14496169 | Not Available | 620 | Open in IMG/M |
| 3300031124|Ga0308151_1012652 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 799 | Open in IMG/M |
| 3300031128|Ga0170823_15863155 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 808 | Open in IMG/M |
| 3300031152|Ga0307501_10153507 | Not Available | 627 | Open in IMG/M |
| 3300031411|Ga0102761_10172337 | Not Available | 912 | Open in IMG/M |
| 3300031421|Ga0308194_10106444 | Not Available | 814 | Open in IMG/M |
| 3300031455|Ga0307505_10080190 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1455 | Open in IMG/M |
| 3300031458|Ga0315836_111462 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 738 | Open in IMG/M |
| 3300031838|Ga0307518_10072412 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 2495 | Open in IMG/M |
| 3300032209|Ga0334665_111500 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1072 | Open in IMG/M |
| 3300032502|Ga0214490_1100786 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 660 | Open in IMG/M |
| 3300032515|Ga0348332_13258622 | All Organisms → cellular organisms → Eukaryota | 3034 | Open in IMG/M |
| 3300032551|Ga0321339_1121304 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 587 | Open in IMG/M |
| 3300032739|Ga0315741_10358093 | Not Available | 1104 | Open in IMG/M |
| 3300032740|Ga0325411_1106610 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 618 | Open in IMG/M |
| 3300032823|Ga0314723_1032801 | Not Available | 984 | Open in IMG/M |
| 3300032896|Ga0335075_10136091 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 3107 | Open in IMG/M |
| 3300033523|Ga0314768_1068975 | Not Available | 1200 | Open in IMG/M |
| 3300033525|Ga0314758_1078507 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea | 924 | Open in IMG/M |
| 3300033526|Ga0314761_1097121 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 655 | Open in IMG/M |
| 3300033528|Ga0316588_1069752 | Not Available | 862 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.95% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 4.17% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 4.17% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 4.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.98% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.38% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.38% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 2.38% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.79% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 1.79% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.19% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.19% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.19% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.19% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.19% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.60% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.60% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.60% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.60% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.60% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.60% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.60% |
| Enriched Soil Aggregate | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.60% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.60% |
| Feces | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Feces | 0.60% |
| Delisea Pulchra | Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.60% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Root Nodules | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.60% |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 0.60% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.60% |
| Xylem | Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem | 0.60% |
| Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 0.60% |
| Solar Panel Surfaces | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Solar Panel Surfaces | 0.60% |
| Solar Cell Surface | Engineered → Built Environment → Solar Panel → Unclassified → Unclassified → Solar Cell Surface | 0.60% |
| Processed Fermented Consumer Product | Engineered → Food Production → Unclassified → Unclassified → Unclassified → Processed Fermented Consumer Product | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000305 | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly | Host-Associated | Open in IMG/M |
| 3300001161 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 | Environmental | Open in IMG/M |
| 3300001169 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300002018 | Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - BBAY61 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002677 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF124 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003328 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-6-R (Metagenome Metatranscriptome, Counting Only) | Engineered | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300003571 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_35 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004967 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 68 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004971 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005640 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005644 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005646 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006020 | Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006423 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_056 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006696 | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2498 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006703 | Marine microbial communities from the Deep Indian Ocean - MP1200 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Host-Associated | Open in IMG/M |
| 3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
| 3300009249 | Microbial communities of water from Amazon river, Brazil - RCM15 | Environmental | Open in IMG/M |
| 3300009254 | Microbial communities of water from Amazon river, Brazil - RCM20 | Environmental | Open in IMG/M |
| 3300009325 | Processed tobacco microbial communities from USA domestic dry snuff from retail store in Atlanta, GA, USA - Dry Snuff D1 2x mi-seq runs combined | Engineered | Open in IMG/M |
| 3300009352 | Microbial communities of water from Amazon river, Brazil - RCM18 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010061 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010063 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010069 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010106 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010110 | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010854 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010872 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 5) | Environmental | Open in IMG/M |
| 3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011023 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 29 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012068 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC073 MetaG | Host-Associated | Open in IMG/M |
| 3300012099 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL041 MetaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012727 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012754 | Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012781 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012894 | Solar panel surface microbial communities from Lawrence Berkeley National Laboratory, California, USA - L | Engineered | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013312 | Solar panel surface microbial communities from Valencia, Spain - panel 3 | Engineered | Open in IMG/M |
| 3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018504 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002418 (ERX1782261-ERR1712132) | Environmental | Open in IMG/M |
| 3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021333 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021342 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300023708 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027176 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027303 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027766 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028019 | Spruce roots microbial communities from Bohemian Forest, Czech Republic ? CRU1 | Host-Associated | Open in IMG/M |
| 3300028181 | Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0762-MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028452 | Goat Fecal Pellet Co-assembly of all samples treated with chloramphenicol from Gen5 and Gen10 | Host-Associated | Open in IMG/M |
| 3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030501 | Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2) | Host-Associated | Open in IMG/M |
| 3300030563 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030576 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb9 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030592 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030614 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb10 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030758 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030799 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030817 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T25 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030860 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030875 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030890 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T29 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030908 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030920 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030938 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030979 | Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030983 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T33 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031009 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 10 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031048 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 13 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031061 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T19 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031065 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031073 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031124 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031411 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031458 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Host-Associated | Open in IMG/M |
| 3300032209 | Metatranscriptome of plant-associated microbial communities from Arabidopsis thaliana in University of Tennessee, Knoxville, TN, United States - Col_370_1 (Metagenome Metatranscriptome) (v2) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032739 | Forest Soil Metatranscriptomics Site 2 LB Combined Assembly | Environmental | Open in IMG/M |
| 3300032740 | Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4 | Host-Associated | Open in IMG/M |
| 3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033525 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| bgg_mtDRAFT_10230511 | 3300000305 | Host-Associated | MNEYLILDPKPSDLTMIRVIKARMGYRCKDIQRIVVS* |
| bgg_mtDRAFT_10309981 | 3300000305 | Host-Associated | DIPDKPIILMIKYLILDPKPSDLTMIRVIKARTGYRCKDTEELW* |
| bgg_mtDRAFT_10309991 | 3300000305 | Host-Associated | MIKYLILDPKPSDLTMIRVIKARTGYRCKDTEELW* |
| JGI12135J13285_1001533 | 3300001161 | Forest Soil | MKKYLKLDPKPSDLTTVRIIKVRTGYRCKDIRRTVVS* |
| JGI12661J13543_1001092 | 3300001169 | Forest Soil | MNKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS* |
| C688J14111_101110871 | 3300001305 | Soil | KMRKYLELDPEASDLTIIRIIKVRTGCRCIDIRRMVVSK* |
| JGI12635J15846_100492901 | 3300001593 | Forest Soil | MKKYLKLDPKPGDLTTVRVIKA*TGYRCKDIRRTVVS |
| JGI12635J15846_101959115 | 3300001593 | Forest Soil | MSKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVV |
| JGI12627J18819_100074661 | 3300001867 | Forest Soil | MIKYLSRDPKGSDLTMVRLIKGRMGYRCKDIQRTV |
| JGI24739J22299_100139091 | 3300001989 | Corn Rhizosphere | MNKYLELDPKASDLTMIRVIKARTGYRCKDIRRIVVSK* |
| BBAY61_1001231 | 3300002018 | Delisea Pulchra | KTSLDKPYEKMNKYLELDPKASDLTMVRVIKARTGYRCIDIRRIVVS* |
| JGIcombinedJ26739_1011351961 | 3300002245 | Forest Soil | MNKYLELDPKASDLTMIRVIKARTGYRCIDIRGIVVS* |
| Ga0005475J37263_1046441 | 3300002677 | Forest Soil | MNKYLKLDPKPGDLTMIRVIKARTGYRCKDIRRIVVSSERQN* |
| Ga0006576J49610_10040101 | 3300003328 | Ionic Liquid And High Solid Enriched | TNYGKMNKYLELDPKASDLTMIRVIKARTGYRCIDIRRIVVSW* |
| JGIcombinedJ51221_102810521 | 3300003505 | Forest Soil | EIDYEKMKKYLKLDPKTSDLTVIRIIKVRTGYRCKDIRRIMVS* |
| Ga0007419J51692_10271361 | 3300003571 | Avena Fatua Rhizosphere | DYEKMIKYLELDPEASDLTIIRIIKVRTGCRCIDIRRMVVSK* |
| Ga0006780_10546221 | 3300003735 | Avena Fatua Rhizosphere | DYEKMNKYLILDPETSDLTIIRIIKVRTGYRCIDIRRMMVS* |
| Ga0072330_11967382 | 3300004967 | Peatlands Soil | DHKQNEKYLILDPKTSDLTIVRIIKVRTGYRCKDIRRTVVSK* |
| Ga0072324_10270111 | 3300004971 | Peatlands Soil | MIKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVEVSERQ |
| Ga0066673_104320421 | 3300005175 | Soil | IMNKYLKLDPKTSDLTIIRIIKVRTGYRCIDIRRIIVSK* |
| Ga0070661_1008279501 | 3300005344 | Corn Rhizosphere | KENDKYLKLDPKLNDLTIIRIIKVRTGYRCKDIRRIMVSK* |
| Ga0066707_110247481 | 3300005556 | Soil | FVNEKYLKLDPKASDLTLIRVIKARTGYRCIDIR* |
| Ga0068852_1008245861 | 3300005616 | Corn Rhizosphere | YLIRDPKSSDLTMVRLIKGRMGYRCKDIQRTVVS* |
| Ga0075035_11119431 | 3300005640 | Permafrost Soil | NKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS* |
| Ga0075035_11193252 | 3300005640 | Permafrost Soil | FWVASKFLILDPKRSDLTMIRLLKDRTVWRCIAIRRIVVSW* |
| Ga0075036_10412071 | 3300005644 | Permafrost Soil | KYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS* |
| Ga0075040_10062871 | 3300005646 | Permafrost Soil | NKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRIMVS* |
| Ga0068866_107537551 | 3300005718 | Miscanthus Rhizosphere | KYLKLDPKLNDLTIIRIIKVRTGYRCIDIRRIMVSK* |
| Ga0068862_1020294201 | 3300005844 | Switchgrass Rhizosphere | LREIDYEKMRKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRMVVSK* |
| Ga0066788_100013991 | 3300005944 | Soil | MNKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVEVSERQH |
| Ga0066789_102261832 | 3300005994 | Soil | MIKYLTLDPKPGDLTTVRIIKVRTGYRCKDIRRTVVS* |
| Ga0066790_100404435 | 3300005995 | Soil | MKKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS* |
| Ga0058704_101884361 | 3300006020 | Agave | YLKLDPKPSDLTMVRVIKARTGYRCIDIRRTVVSW* |
| Ga0070717_105191051 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTV |
| Ga0075514_19284932 | 3300006403 | Aqueous | MKKYLKLDPKASDLTMVRVVKARTGYRCIDIRRTVVSW* |
| Ga0075039_11018371 | 3300006423 | Permafrost Soil | MKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVISERQH |
| Ga0075039_11036681 | 3300006423 | Permafrost Soil | MKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVEVSERQ |
| Ga0075037_11788731 | 3300006426 | Permafrost Soil | MKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVEVSERQH |
| Ga0031674_11711281 | 3300006696 | Deep Ocean | IDRQCLELDPKPSDLTIIRKNQKVRTDYRSKDIR* |
| Ga0005508_12022641 | 3300006703 | Deep Ocean | DYEKMMEYLKLDPETSDLTVIRIIKVRTGYRCKDIRGIMVS* |
| Ga0073928_103039972 | 3300006893 | Iron-Sulfur Acid Spring | NYEIMNKYLKLDPKPSDLTIIRVIKARTGYRCKDIR* |
| Ga0099826_105036351 | 3300006948 | Root Nodules | MIKYLILDPKPSDLTMIRNKVRTVYRCIDIRKIMVSIVKDKSD* |
| Ga0103861_100690641 | 3300009247 | River Water | KYLILDPKPSDLTMIRVIKARMAYRCKDIQRIVVS* |
| Ga0103862_10432161 | 3300009249 | River Water | KKMSKYLGLDPKASDLTMVRVIKARTGYRCIDIRRTVVSW* |
| Ga0103867_10273821 | 3300009254 | River Water | IMNEYLILDPKPSDLTMIRVIKARMAYRCKDIQRIVVS* |
| Ga0116603_1047112 | 3300009325 | Processed Fermented Consumer Product | MNKYLELDPKASDLTMIRVIKARTGYRCKDIRRIVVS* |
| Ga0103865_10089351 | 3300009352 | River Water | NEYLILDPKPSDLTMIRVIKARMAYRCKDIQRIVVS* |
| Ga0116117_10727561 | 3300009635 | Peatland | YLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS* |
| Ga0126309_109554031 | 3300010039 | Serpentine Soil | MNKCLNRDPKGSDLTMVRLIKGRMGYRCKDIQRTVVS |
| Ga0127462_1647641 | 3300010061 | Grasslands Soil | YEIMNKYLKLDPKPGDLTMIRVIKARTGYRCKDIR* |
| Ga0127431_1022721 | 3300010063 | Grasslands Soil | DHPSNEQCLNLDPKPGDLTLIRIIKVRTGYRSIDIRRIMVS* |
| Ga0127467_1477671 | 3300010069 | Grasslands Soil | DYEKMNKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRIMVS* |
| Ga0127472_10520621 | 3300010106 | Grasslands Soil | MNKYLKLDPKTSDLTIIRIIKVRTGYRCIDIRRIIVSK* |
| Ga0126316_10322051 | 3300010110 | Soil | IDYEKMRKYLKLDPKTSDLTVIRIIKVRTGYRCKDIRRIMVS* |
| Ga0127464_12175021 | 3300010139 | Grasslands Soil | DYEKMNKYLKLDPETSDLTIIRIIKVRTGCRCIDIRGIMVS* |
| Ga0126320_11598351 | 3300010146 | Soil | SDYEKMNKYLKLDPETSDLTIIRIIKVRTGCRCIDIRGIMVS* |
| Ga0134062_105226721 | 3300010337 | Grasslands Soil | EIMNKYLKLDPKPGDLTMIRVIKARTGYRCKDIR* |
| Ga0126360_10968551 | 3300010854 | Boreal Forest Soil | DYEKMNKYLKLDPETSDLTIIRIIKVRTGYRCIDIRRIMVSK* |
| Ga0126358_11002071 | 3300010856 | Boreal Forest Soil | EKMNKYLKLDPETSDLTIIRIIKVRTGYRCIDIRGIMVS* |
| Ga0126357_13095671 | 3300010864 | Boreal Forest Soil | YLNLDPKTSDLTMIRVIKARTGYRCKDIRRIVVS* |
| Ga0126347_12050901 | 3300010867 | Boreal Forest Soil | MRAAMPRETNYEIMKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTV |
| Ga0136897_110855621 | 3300010872 | Soil | YLILDPKPSDLTMIRVIKARMVYRCKDIQRIVVS* |
| Ga0138112_10441841 | 3300010905 | Grasslands Soil | QLFVNEKYLKLDPKASDLTLIRVIKARTGYRCIDIR* |
| Ga0138548_1018151 | 3300011023 | Peatlands Soil | NYETMMKYLRLDPKPSDLTMIRIIKVRTAYRCKDIRRIMVS* |
| Ga0150983_132333061 | 3300011120 | Forest Soil | MILREIDYEKMIKYLKLDPKTSDLTVIRIIKVRTGYRCKDIRRI |
| Ga0126317_104957311 | 3300011332 | Soil | DYEKMRKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRMVVSK* |
| Ga0126317_110197241 | 3300011332 | Soil | LKLDPRPSDLTIIRIIKVRTVYRSIDIRRIMVSIVKDNTD* |
| Ga0153989_10178601 | 3300012068 | Attine Ant Fungus Gardens | YLKLDPKPGDLTMIRVIKARTGYRCKDIRRIVVS* |
| Ga0153957_1022681 | 3300012099 | Attine Ant Fungus Gardens | YLKLDPLTSDLTFIRIIKVRTGYRCKDIRRINVS* |
| Ga0150985_1147002251 | 3300012212 | Avena Fatua Rhizosphere | SIKIKIIKYIVLDPKPSDLTMIRSKVRTDYRCKDIRRIVVS* |
| Ga0137385_106872311 | 3300012359 | Vadose Zone Soil | MKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVV |
| Ga0134027_10222621 | 3300012364 | Grasslands Soil | MNKYLKLDPKTSDLTIIRIIKVRTGYRCIDIRRIIVS |
| Ga0134037_11072071 | 3300012372 | Grasslands Soil | LILDPKPSDFTIIRVIKARTGYRCKDIRGIMVGK* |
| Ga0134039_12419361 | 3300012374 | Grasslands Soil | MNKYLKLDPKTSDLTIIRIIKVRTGYRCIDIRRIIV |
| Ga0134034_12315551 | 3300012375 | Grasslands Soil | KYLKLDPKPSDLTMIRIIKVRTGYRCIDIRRIVVSW* |
| Ga0134053_14331931 | 3300012406 | Grasslands Soil | NEQCLNLDPKPGDLTLIRIIKVRTGYRSIDIRRIMVS* |
| Ga0157531_10301721 | 3300012727 | Freshwater | LKLDPKPGDLTTVRIIKVRTGYRCKDIRRTVVSK* |
| Ga0138278_10531811 | 3300012754 | Freshwater Lake | DHNVTENDKCLKLDPKPSDLTIVRAIKARTGYCCKNIR* |
| Ga0138286_11473551 | 3300012781 | Freshwater Lake | MNKYLKLDPKASDLTMVRVVKARTGYRCIDIRGTVVS* |
| Ga0160427_101300445 | 3300012894 | Solar Cell Surface | MNKYLILDPKPSDLTMIRVIKARMVYRCKDIQRIVV |
| Ga0170791_163181221 | 3300013295 | Freshwater | RKYLKLDPETSDLTVIRIIKVRTGYRCKDIRGIMVS* |
| Ga0173631_11267401 | 3300013312 | Solar Panel Surfaces | MNEYLILDPKPSDLTMIRVIKARMVYRCKDIQRIVVS* |
| Ga0182230_10386271 | 3300017417 | Miscanthus Phyllosphere | MNKYLIRDPKSSDLTMVRLIKGRMGYRCKDIQRTVVS |
| Ga0182214_10803501 | 3300017440 | Switchgrass Phyllosphere | MIKYLMLDPKPSDLTMIRVIKARMGYRCKDIQRIV |
| Ga0190275_117837401 | 3300018432 | Soil | MKEYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS |
| Ga0193465_1000033 | 3300018504 | Marine | MNEYLILDPKPSDLTMIRVIKARMAYRCKDIQRIVVS |
| Ga0180106_12147921 | 3300019212 | Groundwater Sediment | TGYEIMNKYLKLDPKPSDLTMIRIIKVRTGYRFKDIRRIMVS |
| Ga0181502_12715601 | 3300019242 | Peatland | MKKYLKLDPKPGDLTTVRVIKARTGYRCRDIRRTVV |
| Ga0184641_11021891 | 3300019254 | Groundwater Sediment | REIDYEKMRKYLKLDPKTSDLTVIRIIKVRTGYRCKDIRRIMVS |
| Ga0184647_12579221 | 3300019263 | Groundwater Sediment | LDPKPGDLTIIRIIKVRTGYRCKDIRRIMVSIVKDKTD |
| Ga0184642_12555351 | 3300019279 | Groundwater Sediment | MSEYLKLDPKPSDLTTIRIIKVRTGYRCKDIRRIVVSK |
| Ga0184649_11016681 | 3300020068 | Groundwater Sediment | DYIYMTKYLKLDPKPSDLTIIRIIKVRTGYRCKDIRRIMAS |
| Ga0210404_100169191 | 3300021088 | Soil | MNKYLELDPKASDLTMIRVIKARTGYRCIDIRGIVVS |
| Ga0210324_11062191 | 3300021333 | Estuarine | PIIKENDKYLKLDPKLNDLTIVRAIKVRTGYRCKDIRRTMVSE |
| Ga0206691_14668111 | 3300021342 | Seawater | DYEKMMEYLKLDPETSDLTVIRIIKVRTGYRCKDIRGIMVS |
| Ga0210393_105327561 | 3300021401 | Soil | MNKYLKLDPKPGDLTTVRVIKARTGYRCRDIRRTVVS |
| Ga0210397_104051861 | 3300021403 | Soil | ERMNKYLKLDPKPGDLTTVRIIKVRTGYRCKDIRRTVVS |
| Ga0213852_10087051 | 3300021858 | Watersheds | MIKYLTLDPKPGDLTTVRIIKVRTGYRCKDIRRTVVS |
| Ga0213851_13103352 | 3300021860 | Watersheds | MIKYLTLDPKPGDLTTVRIIKVRTGYRCKDIRRTV |
| Ga0224712_101057681 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | FRREIDYEKMIKYLKLDPKTSDLTVIRIIKVRTGYRCKDIRRIMVS |
| Ga0242658_10802161 | 3300022530 | Soil | MKKYLKLDPKPSDLTMVRIIKVRTGYRCKDIRRTVV |
| Ga0242658_11200081 | 3300022530 | Soil | MIKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS |
| Ga0242662_100611191 | 3300022533 | Soil | KNIKYLKLDPKSSDLTIVRIIKVRTGYRCIDIRRTMVSIVKDNS |
| Ga0224551_10551771 | 3300023259 | Soil | MPREINYEIMNKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS |
| Ga0228709_10038851 | 3300023708 | Freshwater | MNKYLNRDPKDSDLTVIRLIKGRMGYRCKDIQRIMVS |
| Ga0207671_103651781 | 3300025914 | Corn Rhizosphere | MNKYLNRDPKSSDLTMVRLIKGRMGYRCKDIQRTVVS |
| Ga0207675_1013850931 | 3300026118 | Switchgrass Rhizosphere | TSNEQCLNLDPKPGDLTLIRIIKVRTGYRSIDIRRIMVS |
| Ga0209849_10012407 | 3300026215 | Soil | MNKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTV |
| Ga0209155_11793881 | 3300026316 | Soil | IKYLKLDPKPSDLTMIRIIKVRMGYRCKDIQRIMVS |
| Ga0209620_10016991 | 3300026911 | Forest Soil | IDYEKMNKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRIMVS |
| Ga0208992_10013211 | 3300027176 | Forest Soil | MKKYLKLDPKPSDLTTVRIIKVRTGYRCKDIRRTV |
| Ga0208999_10036585 | 3300027303 | Forest Soil | MKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTV |
| Ga0209796_102764261 | 3300027766 | Agave | EIDYEKMKKYLKLDPETSDLTVIRIIKVRTGYRCKDIR |
| Ga0224573_10035842 | 3300028019 | Roots | MNKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS |
| Ga0256909_10768711 | 3300028181 | Enriched Soil Aggregate | REIDYEKMIKYLELDPEASDLTIIRIIKVRTGCRCIDIRRMVVSK |
| Ga0307247_100751081 | 3300028452 | Feces | MSKYLGLDPKASDLTMVRVIKARTGYRCIDIRRTV |
| Ga0302141_11076101 | 3300029919 | Bog | IMKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS |
| Ga0302271_103784921 | 3300029998 | Bog | NLNEKYLILDPKPSDLTMIRIIKVRTNYCSINIRRIMVSSERQNLLG |
| Ga0268244_100849031 | 3300030501 | Agave | NKYLILDPKPSDLTMIRIIKVRMVYRCKDIQRIVVS |
| Ga0268244_105231831 | 3300030501 | Agave | MNEYLILDPKPSDLTMIRVIKARMVYRCKDIQRIV |
| Ga0247653_10071351 | 3300030563 | Soil | VEKSIMKKKMIKYLRLDPKTSDLTVIRIIKVRTGYRCKDIRRMVVSK |
| Ga0247644_10765591 | 3300030576 | Soil | LKLDPKPSDLTIVRTIKVRTGYCCKNIRRTMVSIVKDNSD |
| Ga0247612_12041501 | 3300030592 | Soil | PKPGDFTIIRVIKARTGYRSKDIRRIMVSLVKDKS |
| Ga0247657_100374921 | 3300030614 | Soil | SDKTIIIYMKKYLKLDPKPSDLTIIRIIKVRTGYRCKDIR |
| Ga0138305_15580651 | 3300030758 | Soil | IKYLTLDPKPGDLTTVRIIKVRTGYRCKDIRRTVVS |
| Ga0074010_101756911 | 3300030799 | Soil | NKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS |
| Ga0315864_1135271 | 3300030817 | Plant Litter | MNKYLIRDPKSSDLTMVRLIKGRMGYRCKDIQRTVV |
| Ga0074000_100808431 | 3300030860 | Soil | MKKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTV |
| Ga0265727_1018411 | 3300030875 | Soil | MNKYLKLDPKPSDLTTVRIIKVRTGYRCKDIRRTVVS |
| Ga0315875_1262561 | 3300030890 | Plant Litter | IKYLMLDPKAGDLTMIRVIKARTGYRCTDIRRIVVSW |
| Ga0074005_101809471 | 3300030908 | Soil | KKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS |
| Ga0102762_10455021 | 3300030920 | Soil | MLREIDYEKMRKYLKLDPETSDLTVIRIIKVRTGYRCKDIRRIMVS |
| Ga0138299_109968831 | 3300030938 | Soil | DKYLKLDPKPSDLTMIRIIKVRTGYRCIDIRRIVVSW |
| Ga0068589_117770341 | 3300030979 | Soil | LILDPKPSDLTMIRIIKVRTVYRSKDIRRIVVSLVKDNTD |
| Ga0315886_1180791 | 3300030983 | Plant Litter | YLMLDPKTGDLTMIRVIKARTGYRCTDIRRIVVSW |
| Ga0308190_12025182 | 3300030993 | Soil | RSLKKNGKYLKLDPKPGDLTIVTTIKVGTGYCSKNIRRTMVG |
| Ga0074022_10794931 | 3300031009 | Soil | NYEIMSKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS |
| Ga0074022_11264761 | 3300031009 | Soil | MSKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVV |
| Ga0074025_13281851 | 3300031048 | Soil | MLREIDYEKMRKYLELDPETSDLTIIRIIKVRTGYRCKDIRRIMVS |
| Ga0170834_1129832941 | 3300031057 | Forest Soil | KKYLKLDPKPSDLTMVRIIKVRTGYRCKDIRRIVVSLVKDNF |
| Ga0315844_1140041 | 3300031061 | Plant Litter | MNEYLILDPKPSDLTMIRVIKARMVYRCKDIQRIVVS |
| Ga0315807_1130332 | 3300031065 | Plant Litter | YLMLDPKAGDLTMIRVIKARTGYRCTDIRRIVVSW |
| Ga0315818_1224521 | 3300031073 | Plant Litter | SYEIMIKYLRLDPKPSDLTMIRVIKARTGYRCKDIRRIVVS |
| Ga0308185_10079771 | 3300031081 | Soil | DYDLINKYLKLDPKPGDLTMIRVIKARTGYRCKDIR |
| Ga0308204_100053821 | 3300031092 | Soil | EIMNKYLKLDPKPSDLTMVRVIKARTGYRYIDIRRTVVSW |
| Ga0308193_10074451 | 3300031096 | Soil | MNKYLKLDPETSDLTIIRIIKVRTGYRCIDIRRIMVSK |
| Ga0170822_108363041 | 3300031122 | Forest Soil | EKYLKLDPKPSDHAIIRVIKVRTGYRCIDIRRIMASS |
| Ga0170822_144961691 | 3300031122 | Forest Soil | KYLKLDPKPSDLTMIRIIKVRTGYRCIDIRRIVVSW |
| Ga0308151_10126521 | 3300031124 | Soil | EKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS |
| Ga0170823_158631551 | 3300031128 | Forest Soil | TNYEIMKKYLKLDPKPGDLTTVRVIKARTAYRCKDIRRTVVS |
| Ga0307501_101535071 | 3300031152 | Soil | TIIIYMKKYLKLDPKPSDLTIIRIIKVRTGYRCKDIR |
| Ga0102761_101723371 | 3300031411 | Soil | MLREIDYEKMRKYLKLDPETSDLTVIRIIKVRTGYRCKDIRRITVS |
| Ga0308194_101064441 | 3300031421 | Soil | NKYLKLDPKSSDFTIIRIIKVRTGYRCKDIRRIMVSK |
| Ga0307505_100801901 | 3300031455 | Soil | DYEKMRKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRMVVSK |
| Ga0315836_1114621 | 3300031458 | Plant Litter | YLKLDPKPGDLTMIRVIKARTGYRCKDIRRIVVSK |
| Ga0307518_100724121 | 3300031838 | Ectomycorrhiza | MNKYLELDPKASDLTMIRVIKARTGYRCKDIRRIVVS |
| Ga0334665_1115001 | 3300032209 | Host-Associated | NYEKMNKYLGLDPKASDLTMIRVVKARTGYRCKDIR |
| Ga0214490_11007861 | 3300032502 | Switchgrass Phyllosphere | NYEKMKKYLNLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS |
| Ga0348332_132586221 | 3300032515 | Plant Litter | MLDPKSGDLTIIRIIKVRTGYRCRDIRRIMVSLVKDNA |
| Ga0321339_11213041 | 3300032551 | Switchgrass Phyllosphere | KYLTLDPKPGDLTTVRIIKVRTGYRCKDIRRIVVGSERQH |
| Ga0315741_103580932 | 3300032739 | Forest Soil | LREIDYEKMRKYLKLDPETSDLTVIRIIKVRTGYRYKDIRRITVS |
| Ga0325411_11066101 | 3300032740 | Xylem | KKMIKFLTLDPKASDLTIVRIIKVRTGYRCIDIRRMVVSK |
| Ga0314723_10328011 | 3300032823 | Switchgrass Phyllosphere | NRLCVNEKYLKLDPKTSDLTIIRILMVRTAYRCIDIRGVVVSR |
| Ga0335075_101360911 | 3300032896 | Soil | MNKYLGLDLKASDLTMIRVIKARTGYRCIDIRRIVVS |
| Ga0314768_10689751 | 3300033523 | Switchgrass Phyllosphere | LELDPKPSDLTIIRKNKKVRTDYRSKDIRRIMVSK |
| Ga0314758_10785071 | 3300033525 | Switchgrass Phyllosphere | MNEYLIRDPKSSDLTMVRLIKGRMGYRCKDIQRTVV |
| Ga0314761_10971211 | 3300033526 | Switchgrass Phyllosphere | KNDKYLELDPKPSDLTTVRAIKARTGYRCKDIRGTVVS |
| Ga0316588_10697521 | 3300033528 | Rhizosphere | DPKPGDLTIIRVIKARTAYRSIDIRRIMVRIVKDNTD |
| ⦗Top⦘ |