NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006703

3300006703: Marine microbial communities from the Deep Indian Ocean - MP1200 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300006703 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054906 | Ga0005508
Sample NameMarine microbial communities from the Deep Indian Ocean - MP1200 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size79805544
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii1
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationIndian Ocean
CoordinatesLat. (o)-30.1996Long. (o)103.1843Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037232Metagenome / Metatranscriptome168Y
F037234Metagenome / Metatranscriptome168Y
F074005Metagenome / Metatranscriptome120N
F093997Metagenome / Metatranscriptome106N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0005508_1025136All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii859Open in IMG/M
Ga0005508_1197319Not Available566Open in IMG/M
Ga0005508_1202264Not Available597Open in IMG/M
Ga0005508_1209835Not Available652Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0005508_1025136Ga0005508_10251361F037232RYPRQASFVIMSAFKIYDLVNTVYGTGYVAAIRSDCYVVLLTHWKLAQGQSPTLYLQAEAMTLIPGALPGTVVKTPFGPAQLQSVRADNMHIAKPINWKLANNTIATMYLQPEVVQLTQTPGFNEGDEVMTVYGQGFVQSKREKEGDLVVLLRNWALAQGQSPTCYLHPSACVKIPGLQIGAAMKTVWGLMRLLSIRRDGTHVCEAMHWNLADGKPPRCYLAPEAFALVSIKP*
Ga0005508_1197319Ga0005508_11973191F093997DVGAKVTVPRDPYPQGVQAGLDDDRSGEDKPASDKGGLKMQKKSDDDTELIEKAEHSFNTETPRPNASIENVDKSIKDSSLILKDARAEGYEGLSQVARNILNGKYYVPSDDEVRGF*
Ga0005508_1202264Ga0005508_12022641F037234DYEKMMEYLKLDPETSDLTVIRIIKVRTGYRCKDIRGIMVS*
Ga0005508_1209835Ga0005508_12098352F074005MVQIRTIDELEALYYGYNRNLLRKADAPITTSTVGVFNAIYGAYAWAQLNLEANAFGILPKYPWDKSGWR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.