3300002018: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - BBAY61

Overview

Basic Information

• IMG/M Taxon OID: 3300002018
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0103015 | Gp0060372 | Ga0016923
• Sample Name: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - BBAY61
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 13943436
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease
• Type: Host-Associated
• Taxonomy: Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: Bare Island, Sydney, Australia
• Coordinates
  • Lat. (^o): -33.59
  • Long. (^o): 151.13
  • Alt. (m): N/A
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037234	Metagenome / Metatranscriptome	168	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
BBAY61_100123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1078

Sequences

Scaffold ID	Protein ID	Family	Sequence
BBAY61_100123	BBAY61_1001231	F037234	KTSLDKPYEKMNKYLELDPKASDLTMVRVIKARTGYRCIDIRRIVVS*