| Basic Information | |
|---|---|
| Family ID | F013050 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 275 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSKGKQPRTRVNKVPKLLLSEIKEVFILYDQEIGLEAAIF |
| Number of Associated Samples | 232 |
| Number of Associated Scaffolds | 275 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.68 % |
| % of genes near scaffold ends (potentially truncated) | 20.36 % |
| % of genes from short scaffolds (< 2000 bps) | 63.27 % |
| Associated GOLD sequencing projects | 221 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.727 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (9.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (33.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 275 Family Scaffolds |
|---|---|---|
| PF00510 | COX3 | 2.55 |
| PF00499 | Oxidored_q3 | 2.55 |
| PF00961 | LAGLIDADG_1 | 1.45 |
| PF01541 | GIY-YIG | 1.09 |
| PF00033 | Cytochrome_B | 0.73 |
| PF07460 | NUMOD3 | 0.73 |
| PF00361 | Proton_antipo_M | 0.73 |
| PF00119 | ATP-synt_A | 0.73 |
| PF03161 | LAGLIDADG_2 | 0.73 |
| PF00032 | Cytochrom_B_C | 0.36 |
| PF13631 | Cytochrom_B_N_2 | 0.36 |
| PF00115 | COX1 | 0.36 |
| PF06455 | NADH5_C | 0.36 |
| PF00137 | ATP-synt_C | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 275 Family Scaffolds |
|---|---|---|---|
| COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 2.55 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 2.55 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 1.09 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.73 |
| COG1009 | Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit | Energy production and conversion [C] | 0.73 |
| COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.73 % |
| All Organisms | root | All Organisms | 43.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000305|bgg_mtDRAFT_1018705 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 563 | Open in IMG/M |
| 3300000305|bgg_mtDRAFT_1050411 | Not Available | 1312 | Open in IMG/M |
| 3300001078|JGI12640J13246_100162 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1388 | Open in IMG/M |
| 3300001079|JGI12696J13243_100027 | Not Available | 4998 | Open in IMG/M |
| 3300001417|JGI20196J14858_1000890 | Not Available | 2505 | Open in IMG/M |
| 3300001661|JGI12053J15887_10217212 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 963 | Open in IMG/M |
| 3300001709|JGI24509J20081_1000495 | Not Available | 9130 | Open in IMG/M |
| 3300001867|JGI12627J18819_10000813 | Not Available | 10466 | Open in IMG/M |
| 3300001867|JGI12627J18819_10010472 | Not Available | 3642 | Open in IMG/M |
| 3300002544|JGI25319J35699_1000761 | Not Available | 16119 | Open in IMG/M |
| 3300002568|C688J35102_120295057 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 974 | Open in IMG/M |
| 3300002568|C688J35102_120758645 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1502 | Open in IMG/M |
| 3300002568|C688J35102_120946351 | All Organisms → cellular organisms → Eukaryota | 2786 | Open in IMG/M |
| 3300002677|Ga0005475J37263_104644 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5 | 911 | Open in IMG/M |
| 3300002915|JGI25387J43893_1014862 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1069 | Open in IMG/M |
| 3300004082|Ga0062384_101449462 | Not Available | 507 | Open in IMG/M |
| 3300004213|Ga0066648_10111314 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1509 | Open in IMG/M |
| 3300004466|Ga0068982_1156361 | Not Available | 966 | Open in IMG/M |
| 3300004470|Ga0068967_1028218 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 2113 | Open in IMG/M |
| 3300004475|Ga0068969_1487594 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis | 590 | Open in IMG/M |
| 3300004478|Ga0068972_1546214 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312 | 1344 | Open in IMG/M |
| 3300004499|Ga0068984_1112487 | Not Available | 628 | Open in IMG/M |
| 3300004506|Ga0068973_1151852 | Not Available | 940 | Open in IMG/M |
| 3300004604|Ga0068943_1288282 | Not Available | 622 | Open in IMG/M |
| 3300004794|Ga0007751_11145751 | Not Available | 507 | Open in IMG/M |
| 3300004970|Ga0072320_1030825 | All Organisms → cellular organisms → Eukaryota | 2837 | Open in IMG/M |
| 3300005347|Ga0070668_100866848 | Not Available | 805 | Open in IMG/M |
| 3300005355|Ga0070671_100467627 | Not Available | 1083 | Open in IMG/M |
| 3300005356|Ga0070674_100245572 | Not Available | 1404 | Open in IMG/M |
| 3300005493|Ga0068672_1104398 | Not Available | 660 | Open in IMG/M |
| 3300005556|Ga0066707_10017006 | Not Available | 3768 | Open in IMG/M |
| 3300005562|Ga0058697_10006375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 3792 | Open in IMG/M |
| 3300005562|Ga0058697_10012974 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 2799 | Open in IMG/M |
| 3300005562|Ga0058697_10106211 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1171 | Open in IMG/M |
| 3300005572|Ga0005500_1043217 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1980 | Open in IMG/M |
| 3300005577|Ga0068857_102454007 | Not Available | 512 | Open in IMG/M |
| 3300005661|Ga0058698_10196650 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1156 | Open in IMG/M |
| 3300005661|Ga0058698_10246397 | Not Available | 1045 | Open in IMG/M |
| 3300005661|Ga0058698_10517812 | Not Available | 735 | Open in IMG/M |
| 3300005661|Ga0058698_10922704 | Not Available | 549 | Open in IMG/M |
| 3300006020|Ga0058704_10001242 | Not Available | 12013 | Open in IMG/M |
| 3300006020|Ga0058704_10066240 | Not Available | 1859 | Open in IMG/M |
| 3300006402|Ga0075511_1810008 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1314 | Open in IMG/M |
| 3300006425|Ga0075486_1046472 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 3351 | Open in IMG/M |
| 3300006426|Ga0075037_1002171 | Not Available | 1379 | Open in IMG/M |
| 3300006644|Ga0099767_1280245 | Not Available | 575 | Open in IMG/M |
| 3300006695|Ga0031682_1164952 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312 | 645 | Open in IMG/M |
| 3300006969|Ga0075419_11178583 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea | 564 | Open in IMG/M |
| 3300007304|Ga0102689_1714314 | Not Available | 535 | Open in IMG/M |
| 3300008686|Ga0104245_1002726 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 653 | Open in IMG/M |
| 3300009144|Ga0058702_10117441 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1018 | Open in IMG/M |
| 3300009411|Ga0115017_1046613 | Not Available | 732 | Open in IMG/M |
| 3300009448|Ga0114940_10236694 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 800 | Open in IMG/M |
| 3300010043|Ga0126380_10007064 | Not Available | 4844 | Open in IMG/M |
| 3300010057|Ga0126365_10878 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 2004 | Open in IMG/M |
| 3300010076|Ga0127430_117754 | Not Available | 1791 | Open in IMG/M |
| 3300010080|Ga0127448_166465 | Not Available | 992 | Open in IMG/M |
| 3300010117|Ga0127449_1133726 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1164 | Open in IMG/M |
| 3300010118|Ga0127465_1023677 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 826 | Open in IMG/M |
| 3300010360|Ga0126372_10002905 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 7683 | Open in IMG/M |
| 3300010855|Ga0126355_1151488 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 3685 | Open in IMG/M |
| 3300010856|Ga0126358_1196816 | All Organisms → cellular organisms → Eukaryota | 2800 | Open in IMG/M |
| 3300010861|Ga0126349_1287649 | Not Available | 974 | Open in IMG/M |
| 3300010862|Ga0126348_1196727 | All Organisms → cellular organisms → Eukaryota | 4047 | Open in IMG/M |
| 3300010864|Ga0126357_1031723 | Not Available | 640 | Open in IMG/M |
| 3300010864|Ga0126357_1055171 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2870 | Open in IMG/M |
| 3300010864|Ga0126357_1204719 | All Organisms → cellular organisms → Eukaryota | 2847 | Open in IMG/M |
| 3300010867|Ga0126347_1033598 | Not Available | 1484 | Open in IMG/M |
| 3300010905|Ga0138112_1080918 | Not Available | 631 | Open in IMG/M |
| 3300010980|Ga0138321_10405382 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5 | 544 | Open in IMG/M |
| 3300011120|Ga0150983_13267219 | All Organisms → cellular organisms → Eukaryota | 3055 | Open in IMG/M |
| 3300011120|Ga0150983_13697764 | Not Available | 795 | Open in IMG/M |
| 3300011340|Ga0151652_13950386 | Not Available | 718 | Open in IMG/M |
| 3300011426|Ga0151147_1147319 | Not Available | 1275 | Open in IMG/M |
| 3300011429|Ga0137455_1027007 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1580 | Open in IMG/M |
| 3300012212|Ga0150985_117910366 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1523 | Open in IMG/M |
| 3300012212|Ga0150985_121582371 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5 | 1003 | Open in IMG/M |
| 3300012375|Ga0134034_1205316 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 810 | Open in IMG/M |
| 3300012381|Ga0134026_1210372 | Not Available | 1633 | Open in IMG/M |
| 3300012385|Ga0134023_1038172 | Not Available | 894 | Open in IMG/M |
| 3300012390|Ga0134054_1109933 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 538 | Open in IMG/M |
| 3300012469|Ga0150984_102729202 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1530 | Open in IMG/M |
| 3300012469|Ga0150984_105353230 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1801 | Open in IMG/M |
| 3300012525|Ga0129353_1587809 | Not Available | 1153 | Open in IMG/M |
| 3300012668|Ga0157216_10003445 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 9566 | Open in IMG/M |
| 3300012763|Ga0138289_1116653 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 545 | Open in IMG/M |
| 3300013024|Ga0170682_1030837 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1097 | Open in IMG/M |
| 3300013308|Ga0157375_10052519 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 4007 | Open in IMG/M |
| 3300013861|Ga0181449_105710 | Not Available | 791 | Open in IMG/M |
| 3300013865|Ga0181471_102685 | Not Available | 2649 | Open in IMG/M |
| 3300014488|Ga0182001_10155348 | Not Available | 786 | Open in IMG/M |
| 3300014501|Ga0182024_11623536 | Not Available | 732 | Open in IMG/M |
| 3300015349|Ga0182185_1000082 | Not Available | 6933 | Open in IMG/M |
| 3300017440|Ga0182214_1069073 | Not Available | 726 | Open in IMG/M |
| 3300017928|Ga0187806_1139768 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 794 | Open in IMG/M |
| 3300017972|Ga0187781_10038528 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales | 3295 | Open in IMG/M |
| 3300018044|Ga0187890_10039216 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 2853 | Open in IMG/M |
| 3300018414|Ga0194135_10644929 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 691 | Open in IMG/M |
| 3300018414|Ga0194135_10967885 | Not Available | 541 | Open in IMG/M |
| 3300018964|Ga0193087_10129041 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312 | 820 | Open in IMG/M |
| 3300019090|Ga0193578_100305 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 3571 | Open in IMG/M |
| 3300019155|Ga0184568_114719 | Not Available | 1445 | Open in IMG/M |
| 3300019192|Ga0184603_135051 | Not Available | 546 | Open in IMG/M |
| 3300019203|Ga0179955_1150172 | Not Available | 1237 | Open in IMG/M |
| 3300019227|Ga0179956_1128424 | Not Available | 783 | Open in IMG/M |
| 3300019240|Ga0181510_1324524 | All Organisms → cellular organisms → Eukaryota | 3145 | Open in IMG/M |
| 3300019241|Ga0187793_1174986 | Not Available | 940 | Open in IMG/M |
| 3300019241|Ga0187793_1299435 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1678 | Open in IMG/M |
| 3300019249|Ga0184648_1315834 | Not Available | 2466 | Open in IMG/M |
| 3300019259|Ga0184646_1246640 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 537 | Open in IMG/M |
| 3300019264|Ga0187796_1369864 | All Organisms → cellular organisms → Eukaryota | 2749 | Open in IMG/M |
| 3300019270|Ga0181512_1401400 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Juglanconidaceae → Juglanconis → Juglanconis juglandina | 1925 | Open in IMG/M |
| 3300020016|Ga0193696_1012302 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 2327 | Open in IMG/M |
| 3300020075|Ga0206349_1451427 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1303 | Open in IMG/M |
| 3300020081|Ga0206354_11233021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 842 | Open in IMG/M |
| 3300020181|Ga0196958_10407508 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 517 | Open in IMG/M |
| 3300020580|Ga0210403_10189840 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1685 | Open in IMG/M |
| 3300020818|Ga0214277_10251906 | Not Available | 2494 | Open in IMG/M |
| 3300021170|Ga0210400_10018844 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 5404 | Open in IMG/M |
| 3300021276|Ga0210354_1007883 | Not Available | 800 | Open in IMG/M |
| 3300021291|Ga0206694_1064822 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 2631 | Open in IMG/M |
| 3300021374|Ga0213881_10200824 | Not Available | 881 | Open in IMG/M |
| 3300021384|Ga0213876_10047080 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 2280 | Open in IMG/M |
| 3300021560|Ga0126371_11472671 | Not Available | 810 | Open in IMG/M |
| 3300021855|Ga0213854_1121586 | Not Available | 659 | Open in IMG/M |
| 3300021857|Ga0213849_1081991 | Not Available | 999 | Open in IMG/M |
| 3300021857|Ga0213849_1152562 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 587 | Open in IMG/M |
| 3300021861|Ga0213853_10500135 | Not Available | 845 | Open in IMG/M |
| 3300022161|Ga0213931_1006514 | Not Available | 1315 | Open in IMG/M |
| 3300022523|Ga0242663_1032823 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 846 | Open in IMG/M |
| 3300023058|Ga0193714_1000005 | Not Available | 27606 | Open in IMG/M |
| 3300023063|Ga0233335_1004430 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 3028 | Open in IMG/M |
| 3300023063|Ga0233335_1069176 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 635 | Open in IMG/M |
| 3300023259|Ga0224551_1011571 | Not Available | 1475 | Open in IMG/M |
| 3300023260|Ga0247798_1003807 | Not Available | 1768 | Open in IMG/M |
| 3300023291|Ga0256703_10253936 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 8856 | Open in IMG/M |
| 3300023533|Ga0247537_101304 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 708 | Open in IMG/M |
| 3300023678|Ga0247538_101738 | Not Available | 869 | Open in IMG/M |
| 3300024049|Ga0233359_1033122 | Not Available | 597 | Open in IMG/M |
| 3300025711|Ga0207696_1056255 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea | 1114 | Open in IMG/M |
| 3300025875|Ga0210040_10566830 | Not Available | 563 | Open in IMG/M |
| 3300026316|Ga0209155_1061113 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1443 | Open in IMG/M |
| 3300026326|Ga0209801_1068679 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 1574 | Open in IMG/M |
| 3300026528|Ga0209378_1129713 | Not Available | 1063 | Open in IMG/M |
| 3300027002|Ga0209110_1000004 | Not Available | 26275 | Open in IMG/M |
| 3300027058|Ga0209111_1001045 | Not Available | 2029 | Open in IMG/M |
| 3300027257|Ga0208996_1023420 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 850 | Open in IMG/M |
| 3300027530|Ga0209216_1030654 | Not Available | 864 | Open in IMG/M |
| 3300027636|Ga0214469_1118785 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 762 | Open in IMG/M |
| 3300027768|Ga0209772_10039846 | Not Available | 1383 | Open in IMG/M |
| 3300027864|Ga0209755_10651499 | Not Available | 900 | Open in IMG/M |
| 3300028142|Ga0268347_1000010 | Not Available | 19561 | Open in IMG/M |
| 3300028573|Ga0265334_10004604 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales | 6100 | Open in IMG/M |
| 3300028586|Ga0265798_10181427 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1834 | Open in IMG/M |
| 3300028786|Ga0307517_10181033 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1360 | Open in IMG/M |
| 3300028906|Ga0308309_10768675 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 837 | Open in IMG/M |
| 3300029908|Ga0311341_10033325 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 4266 | Open in IMG/M |
| 3300030007|Ga0311338_10296978 | Not Available | 1786 | Open in IMG/M |
| 3300030495|Ga0268246_10000502 | Not Available | 16366 | Open in IMG/M |
| 3300030495|Ga0268246_10070466 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1020 | Open in IMG/M |
| 3300030498|Ga0268247_10006411 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 3462 | Open in IMG/M |
| 3300030501|Ga0268244_10004410 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota | 4641 | Open in IMG/M |
| 3300030501|Ga0268244_10012696 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 3000 | Open in IMG/M |
| 3300030501|Ga0268244_10192785 | Not Available | 993 | Open in IMG/M |
| 3300030501|Ga0268244_10843690 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 510 | Open in IMG/M |
| 3300030505|Ga0268245_10006489 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 2164 | Open in IMG/M |
| 3300030521|Ga0307511_10108612 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium → Fusarium sambucinum species complex → Fusarium pseudograminearum | 1779 | Open in IMG/M |
| 3300030571|Ga0247652_1021985 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 879 | Open in IMG/M |
| 3300030574|Ga0247648_1056436 | Not Available | 769 | Open in IMG/M |
| 3300030593|Ga0210263_1084137 | Not Available | 687 | Open in IMG/M |
| 3300030692|Ga0268250_10128708 | Not Available | 1116 | Open in IMG/M |
| 3300030754|Ga0074008_10075164 | Not Available | 780 | Open in IMG/M |
| 3300030754|Ga0074008_11003439 | Not Available | 890 | Open in IMG/M |
| 3300030758|Ga0138305_1558065 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 540 | Open in IMG/M |
| 3300030768|Ga0315877_125611 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 615 | Open in IMG/M |
| 3300030785|Ga0102757_10019853 | Not Available | 627 | Open in IMG/M |
| 3300030810|Ga0265786_111284 | Not Available | 646 | Open in IMG/M |
| 3300030822|Ga0315851_107789 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 756 | Open in IMG/M |
| 3300030840|Ga0074020_10951409 | Not Available | 1006 | Open in IMG/M |
| 3300030890|Ga0315875_108066 | Not Available | 1048 | Open in IMG/M |
| 3300030894|Ga0315884_106321 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 1152 | Open in IMG/M |
| 3300030894|Ga0315884_120360 | Not Available | 650 | Open in IMG/M |
| 3300030897|Ga0315889_122076 | Not Available | 580 | Open in IMG/M |
| 3300030902|Ga0308202_1008848 | Not Available | 1356 | Open in IMG/M |
| 3300030905|Ga0308200_1088166 | Not Available | 643 | Open in IMG/M |
| 3300030915|Ga0061011_11998245 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5 | 1334 | Open in IMG/M |
| 3300030960|Ga0102745_1846002 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5 | 738 | Open in IMG/M |
| 3300030962|Ga0138297_1672352 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Juglanconidaceae → Juglanconis → Juglanconis juglandina | 1172 | Open in IMG/M |
| 3300030988|Ga0308183_1124832 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312 | 611 | Open in IMG/M |
| 3300030993|Ga0308190_1100022 | Not Available | 635 | Open in IMG/M |
| 3300031012|Ga0315887_101582 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1876 | Open in IMG/M |
| 3300031021|Ga0102765_10121012 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 2446 | Open in IMG/M |
| 3300031021|Ga0102765_11611428 | Not Available | 723 | Open in IMG/M |
| 3300031057|Ga0170834_103589551 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1269 | Open in IMG/M |
| 3300031091|Ga0308201_10128235 | Not Available | 769 | Open in IMG/M |
| 3300031231|Ga0170824_121134334 | Not Available | 868 | Open in IMG/M |
| 3300031411|Ga0102761_10166132 | Not Available | 797 | Open in IMG/M |
| 3300031422|Ga0308186_1015132 | Not Available | 707 | Open in IMG/M |
| 3300031426|Ga0315835_100073 | All Organisms → cellular organisms → Eukaryota | 3537 | Open in IMG/M |
| 3300031446|Ga0170820_12822823 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1154 | Open in IMG/M |
| 3300031448|Ga0272438_1000095 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 124066 | Open in IMG/M |
| 3300031449|Ga0272429_1000627 | Not Available | 60460 | Open in IMG/M |
| 3300031449|Ga0272429_1229085 | Not Available | 698 | Open in IMG/M |
| 3300031450|Ga0272433_10001547 | Not Available | 40181 | Open in IMG/M |
| 3300031452|Ga0272422_1040281 | Not Available | 2638 | Open in IMG/M |
| 3300031453|Ga0272425_1003223 | Not Available | 24714 | Open in IMG/M |
| 3300031453|Ga0272425_1004714 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 17793 | Open in IMG/M |
| 3300031453|Ga0272425_1047536 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 2428 | Open in IMG/M |
| 3300031501|Ga0265785_111032 | Not Available | 653 | Open in IMG/M |
| 3300031520|Ga0272428_1044064 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 3695 | Open in IMG/M |
| 3300031520|Ga0272428_1182707 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1068 | Open in IMG/M |
| 3300031808|Ga0316037_103797 | Not Available | 911 | Open in IMG/M |
| 3300032027|Ga0247536_101741 | Not Available | 841 | Open in IMG/M |
| 3300032159|Ga0268251_10059524 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1274 | Open in IMG/M |
| 3300032464|Ga0214492_1088649 | Not Available | 583 | Open in IMG/M |
| 3300032465|Ga0214493_1036482 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1132 | Open in IMG/M |
| 3300032467|Ga0214488_1134623 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 517 | Open in IMG/M |
| 3300032469|Ga0214491_1134772 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 582 | Open in IMG/M |
| 3300032515|Ga0348332_12648907 | Not Available | 691 | Open in IMG/M |
| 3300032625|Ga0214501_1135798 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 785 | Open in IMG/M |
| 3300032758|Ga0314746_1046972 | Not Available | 995 | Open in IMG/M |
| 3300032758|Ga0314746_1072880 | Not Available | 798 | Open in IMG/M |
| 3300032760|Ga0314754_1028941 | Not Available | 876 | Open in IMG/M |
| 3300032761|Ga0314733_1103828 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 531 | Open in IMG/M |
| 3300032782|Ga0335082_10018176 | Not Available | 7608 | Open in IMG/M |
| 3300032789|Ga0314725_1001042 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 2317 | Open in IMG/M |
| 3300032812|Ga0314745_1071087 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 742 | Open in IMG/M |
| 3300032875|Ga0314737_1089198 | Not Available | 512 | Open in IMG/M |
| 3300032915|Ga0314749_1096996 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 634 | Open in IMG/M |
| 3300032954|Ga0335083_11029372 | Not Available | 647 | Open in IMG/M |
| 3300032959|Ga0314738_1042489 | Not Available | 828 | Open in IMG/M |
| 3300033158|Ga0335077_10001850 | Not Available | 25181 | Open in IMG/M |
| 3300033181|Ga0272431_10243068 | Not Available | 967 | Open in IMG/M |
| 3300033528|Ga0316588_1040322 | Not Available | 1115 | Open in IMG/M |
| 3300033530|Ga0314760_1004300 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2619 | Open in IMG/M |
| 3300033530|Ga0314760_1052192 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1010 | Open in IMG/M |
| 3300033539|Ga0314762_1111611 | Not Available | 504 | Open in IMG/M |
| 3300033540|Ga0314764_1032033 | Not Available | 866 | Open in IMG/M |
| 3300033543|Ga0314765_1033174 | Not Available | 1498 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 9.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.27% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 5.45% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 5.45% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 4.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.64% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 3.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.27% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.91% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 2.18% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.45% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.09% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.09% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.09% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.09% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.73% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.73% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.73% |
| Leaf Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter | 0.73% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.73% |
| Fungi-Associated Bovine Rumen | Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen | 0.73% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.73% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.36% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.36% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.36% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.36% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.36% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.36% |
| Continental Margin Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment | 0.36% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 0.36% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.36% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.36% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.36% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.36% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.36% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface | 0.36% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.36% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.36% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.36% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.36% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock | 0.36% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.36% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.36% |
| Elk Feces | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces | 0.36% |
| Rumen | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen | 0.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.36% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.36% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 0.36% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.36% |
| Clean Room | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Clean Room | 0.36% |
| Food Waste | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste | 0.36% |
| Food Waste | Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste | 0.36% |
| Clean Room | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room | 0.36% |
| Fermented Vegetables | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Fermented Vegetables | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000305 | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly | Host-Associated | Open in IMG/M |
| 3300001078 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 | Environmental | Open in IMG/M |
| 3300001079 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001417 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001709 | Marine viral communities from the Pacific Ocean - LP-29 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002544 | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/17 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002677 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF124 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004213 | Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NA | Environmental | Open in IMG/M |
| 3300004466 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 80 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004470 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004478 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004499 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 82 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004506 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 70 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004604 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004970 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005493 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP_0700 MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005572 | Marine microbial communities from the Deep Atlantic Ocean - MP0139 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005661 | Agave microbial communities from Guanajuato, Mexico - As.Sf.e | Host-Associated | Open in IMG/M |
| 3300006020 | Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e | Host-Associated | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006644 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_A2_L (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006695 | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP324 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300008686 | Food microbial communities from the fermentation process of Kimchi from South Korea - J7 | Environmental | Open in IMG/M |
| 3300009144 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.e | Host-Associated | Open in IMG/M |
| 3300009411 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009448 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010057 | Continental margin sediment microbial communities from China - WA_23_40 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010076 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010080 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010855 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010980 | Metatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-1 corn stover (Eukaryote Community Metatranscriptome) (version 8) | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300011426 | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36 Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Host-Associated | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013024 | Gypsum crust hypoendolithic microbial communities from the Atacama Desert, Chile - KM37, HE | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013861 | Clean room spacecraft assembly facility microbial communities from NASA Jet Propulsion Laboratory, California, USA - Floor swab, replicate A SPAdes reassembly | Engineered | Open in IMG/M |
| 3300013865 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In5p-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018414 | Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013 | Environmental | Open in IMG/M |
| 3300018964 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130) | Environmental | Open in IMG/M |
| 3300019090 | Metatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-8 | Environmental | Open in IMG/M |
| 3300019155 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019203 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR2_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019227 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR3_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020818 | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2 | Engineered | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021276 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.491 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021291 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021857 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021967 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - AB:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022161 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300023063 | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-222 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300023260 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6 | Environmental | Open in IMG/M |
| 3300023291 | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada. Combined Assembly of Gp0242115, Gp0242119 | Engineered | Open in IMG/M |
| 3300023533 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023678 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023697 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024049 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30 | Environmental | Open in IMG/M |
| 3300024486 | Metatranscriptome of sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1766 RNA GHGlow gp2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025875 | Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NA (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300027002 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027257 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027530 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027864 | Cornitermes sp. P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028586 | Plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T30 | Environmental | Open in IMG/M |
| 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030495 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.e (v2) | Host-Associated | Open in IMG/M |
| 3300030498 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300030501 | Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2) | Host-Associated | Open in IMG/M |
| 3300030505 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
| 3300030571 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030574 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030593 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030634 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030692 | Agave microbial communities from Guanajuato, Mexico - As.Sf.e (v2) | Host-Associated | Open in IMG/M |
| 3300030754 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030758 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030768 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030810 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030822 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T21 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030827 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T28 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030837 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T27 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030840 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030851 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030890 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T29 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030894 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030897 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T34 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030901 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T29 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030915 | Coassembly of Cow X Corn Stover | Host-Associated | Open in IMG/M |
| 3300030922 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030960 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030962 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031012 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T33 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031021 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031411 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031426 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031448 | Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead nord | Environmental | Open in IMG/M |
| 3300031449 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sud | Environmental | Open in IMG/M |
| 3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
| 3300031452 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand nord | Environmental | Open in IMG/M |
| 3300031453 | Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte sud | Environmental | Open in IMG/M |
| 3300031460 | Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace nord | Environmental | Open in IMG/M |
| 3300031501 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031520 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nord | Environmental | Open in IMG/M |
| 3300031808 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031816 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032027 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032757 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032760 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032789 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032875 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032889 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033181 | Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sud | Environmental | Open in IMG/M |
| 3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033539 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033540 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033543 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| bgg_mtDRAFT_10187052 | 3300000305 | Host-Associated | MSKGKQPRTRVKVPKLLLSEIKKVFIEVDKRIGLEAAII* |
| bgg_mtDRAFT_10504112 | 3300000305 | Host-Associated | MSKGKQPRTRVKVPKLLLSEIKVVFILFGQEMGLGAAIF* |
| JGI12640J13246_1001622 | 3300001078 | Forest Soil | MSKGKQPRTRVIKVPKLLLSEIKEVFIVYNQEIGLEAAIF* |
| JGI12696J13243_1000278 | 3300001079 | Forest Soil | MSKGKQPRTNVKVPKLLLSESKKVFRYINKGIGLEAAII* |
| JGI20196J14858_10008903 | 3300001417 | Arctic Peat Soil | MSKGKQPXTRVKVPKLLLSESKKVFIYVDKIIGLEAAII* |
| JGI12053J15887_102172121 | 3300001661 | Forest Soil | MSKGKQPRTRVNKVPKLLLSEIKAVFIEYDQEIGLEAAIF* |
| JGI24509J20081_10004952 | 3300001709 | Marine | MSKGKQPRTRVKVPKLLLSEIKDVFFQNNQEIGLEAAIF* |
| JGI12627J18819_100008139 | 3300001867 | Forest Soil | MSKGKQPRTRVNKVPKLLLSEIKVVFILFGQEMGLEAAIFLRPRKRALV* |
| JGI12627J18819_100104721 | 3300001867 | Forest Soil | MSKGKQPRTRVKVPKLLLSEIKDVSMKYGQEIGLEAVHFLKIS* |
| JGI25319J35699_10007615 | 3300002544 | Deep Subsurface | MSKGKQPRTRVKVPKLLLSEIKDVFFKYNQEIGLEAAIF* |
| C688J35102_1196947041 | 3300002568 | Soil | MSKGKQPRTRVKVPKLLLSEIKKVFIQVDKEMGLEAAIIQRPRNRALVNF* |
| C688J35102_1202950571 | 3300002568 | Soil | MSKGKQPRTRVKVPKLLVGEIKKVFIKVDKEIGLEAAIIL* |
| C688J35102_1207586452 | 3300002568 | Soil | MSKGKQPRTRVNKVPKLLLSEIKEVFIVYNQEIGLEAAIF* |
| C688J35102_1209463512 | 3300002568 | Soil | MSKGKQPRTRVNKVPKLLLSEIKEVFIVYDQEIGLEAAIF* |
| Ga0005475J37263_1046442 | 3300002677 | Forest Soil | MSKGKQPRTRVKVPKLLLSEIKEVFIVYDQEIGLEAAIF* |
| JGI25387J43893_10148621 | 3300002915 | Grasslands Soil | MSKGKQP*TRVNKVPKLLLSEIKEVYIEYGQEIGLEAAIF |
| Ga0007416J51690_10477321 | 3300003577 | Avena Fatua Rhizosphere | MSKGKQPRTKVKVPKLLLSEIKKVFI*VDKEMGLEAAII*RPRNRALVKSLKASKI* |
| Ga0062384_1014494621 | 3300004082 | Bog Forest Soil | MSKGKQPRTIVNKVPKLLLSENKEVFLPYDQEIGLEAAIF* |
| Ga0066648_101113141 | 3300004213 | Groundwater | MSKGKQPRTSNNKVPKLLLSEIKEVIIKYVQGIGLEAAIF* |
| Ga0068982_11563612 | 3300004466 | Peatlands Soil | MSKGKQPRTRVKVPKLLLSESKKVFIYVDKIIGLEAAII* |
| Ga0068967_10282183 | 3300004470 | Peatlands Soil | MSKGKQPRTRVKVPKLLLSEIKEVSIQYVQGIGLEAAIF* |
| Ga0068969_14875941 | 3300004475 | Peatlands Soil | MSKGKQPRTKVKVPKLLLSEIKKVFFISRQGDSLEAAII* |
| Ga0068969_14994241 | 3300004475 | Peatlands Soil | MSKGKQPRTRVKVPKLLLSENKKVFIYVDKEMGLEAAIIQ*FRNRALVNF* |
| Ga0068972_15462141 | 3300004478 | Peatlands Soil | MSKGKQPRTRVKVPKLLLSENKKVFIYVDKEMGLEAAIIQ* |
| Ga0068984_11124871 | 3300004499 | Peatlands Soil | CMSKGKQPRTRVKVPKLLLSESKKVFIYVDKIIGLEAAII* |
| Ga0068973_11518521 | 3300004506 | Peatlands Soil | MSKGKQPRTRVNKVPKLLLSEIKVVHILYNQGIGLEAVIF* |
| Ga0068943_12882821 | 3300004604 | Peatlands Soil | CMSKGKQPRTRVKVPKLLLSEIKKVFIYVDKVIGLEAAII* |
| Ga0007751_111457511 | 3300004794 | Freshwater Lake | MSKGKQPRTRVKVPKLMLSEIKEVFIIYNQEIGLEAAIF* |
| Ga0072320_10308251 | 3300004970 | Peatlands Soil | MSKGKQPRTRVKVPKLLLSEIKKVFIYVDKVIGLEAAII* |
| Ga0070668_1008668481 | 3300005347 | Switchgrass Rhizosphere | MSKGKQPRTRVNKVPKLLLSEIKVVFILFAQEIGLGAAIF* |
| Ga0070671_1004676272 | 3300005355 | Switchgrass Rhizosphere | MSKGKQPRTRFKVPKLFLSEIKTVSNQDDKKMGLEAAKIL* |
| Ga0070674_1002455721 | 3300005356 | Miscanthus Rhizosphere | MSKGKQPRTRVKVPKLLVGEIKKVIIKVDKEMGLEAAII* |
| Ga0068672_11043982 | 3300005493 | Anoxygenic And Chlorotrophic Microbial Mat | MSKGKQPRASVNKVPKLLLSEIKVVYVLNGQEMGLEAAIF* |
| Ga0066707_100170062 | 3300005556 | Soil | MSKGKQPRTRVKVPKLLLNEIKKVFYKVDKDIGLEAAII* |
| Ga0058697_100063754 | 3300005562 | Agave | MSKGKQPRTRVNKVPKLLLSEIKEVIIKYVQGIGLEAAIF* |
| Ga0058697_100129742 | 3300005562 | Agave | MSKGKQPRTRANKVPKLLLSEIKEVIIIYVQEIGLEAAIF* |
| Ga0058697_101062113 | 3300005562 | Agave | MSKGKQPRTRVKVPKLMLSESKEVFFKYNQEIGLEAAIF* |
| Ga0005500_10432173 | 3300005572 | Deep Ocean | MSKGKQPRTRVKVPKLLLSETKEVFFKYNQEIGLEAAIF* |
| Ga0068857_1024540071 | 3300005577 | Corn Rhizosphere | KQPRTRVKVPKLLVGEIKKVIIKVDKEMGLEAAII* |
| Ga0058698_101966501 | 3300005661 | Agave | MSKGKQPRTSNNKVPKLLLSEIKEVIIKDDQGIGLEAAIF* |
| Ga0058698_102463972 | 3300005661 | Agave | MSKGKQPRTRANKVPKLLLSEIKEVIIKYVQGIGLEAAIF* |
| Ga0058698_105178121 | 3300005661 | Agave | MSKGKQPRTSINKVPKLLLSEIKEVVIKYDQGIGLEAAIF* |
| Ga0058698_109227041 | 3300005661 | Agave | GCMSKGKQPRTRANKVPKLLLSEIKEVIIIYVQEIGLEAAIF* |
| Ga0058704_100012423 | 3300006020 | Agave | MSKGKQPRTRVKVPKLLLSENKEGFFEYNQEIGLEAAIF* |
| Ga0058704_100662402 | 3300006020 | Agave | MSKGKQPRTSNNKVPKLLLSEIKEVIIKYDQGIGLEAAIF* |
| Ga0075511_18100082 | 3300006402 | Aqueous | MSKGKQPRTRVKVPKLSLSEIKDVFFKYNQEIGLEAAIF* |
| Ga0075486_10464723 | 3300006425 | Aqueous | MSKGKQPRTRVKVPKLLLSEIKVVFFKYNQEIGLEAAIF* |
| Ga0075037_10021711 | 3300006426 | Permafrost Soil | MSKGKQPRTRVNKVPKLLLSEKKVVFLTFGQEIGLEAAIF* |
| Ga0099767_12802451 | 3300006644 | Activated Sludge | MSKGKQPKTSIKVPKLLLSEIKEVFFKYDQEIGLEAAIF* |
| Ga0031682_11649522 | 3300006695 | Deep Ocean | MSKGKQPRTRVKVPKLLLSEIKKVFIKVDKEIGLEAAII |
| Ga0075419_111785831 | 3300006969 | Populus Rhizosphere | MSKGKQPRTRFKVPKLFLSEIKTVFNQDDKKMGLEAAKIL*I |
| Ga0102689_17143141 | 3300007304 | Freshwater Lake | MSKGKQPRTRVNKVPKFLLSEIKAVFIPIGQEVGLEAAIF* |
| Ga0104245_10027262 | 3300008686 | Fermented Vegetables | MSKGKQPRTRVKVPKLLLSENKEVFFKYNQEIGLEAAIF* |
| Ga0058702_101174411 | 3300009144 | Agave | MSKGKQPRTRVKVPKLLLSEIKEVFFIYNQEIGLEAAIF*RPRNRALV |
| Ga0115017_10320771 | 3300009411 | Soil | MSKGKQPRTRVKVPKLLLSEIKKVFIQVDKEMGLEAAIIQRYRNRALVNL* |
| Ga0115017_10466131 | 3300009411 | Soil | GCMSKGKQPRTRVNKVPKFLLSEIKAVFILNSQEIGLEAVTF* |
| Ga0114940_102366941 | 3300009448 | Groundwater | MSKGKQPRTRVKVPKLMLSEIKEVSIEYNQEIGLEAAIF* |
| Ga0126380_100070642 | 3300010043 | Tropical Forest Soil | MSKGKQPRTIVIKVPKLLLSEIKEVFIVYDQEIGLEAAIF*RPRNRALV* |
| Ga0126365_108781 | 3300010057 | Continental Margin Sediment | MSKGKQPRTRVKVPKLLLSEIKDVFFKNNQEIGLEAAIF* |
| Ga0127430_1177541 | 3300010076 | Grasslands Soil | MSKGEYPRTKVKVPKLLLSDIKEVLI*NAQEIGLPAAIF* |
| Ga0127448_1664651 | 3300010080 | Grasslands Soil | MSRGKQPRTSVKVPKLLLSEKEKVFCKYNQEIGLVAAIFSRS |
| Ga0127449_11337261 | 3300010117 | Grasslands Soil | MSKGKQPKTRVNKVPKLLLSEKKGCVFEHDQEIGLEAAIF* |
| Ga0127465_10236771 | 3300010118 | Grasslands Soil | MSKGKQPRTRVNKVPKLLLSEIKEVFIVYNQEIGLEAAIF*RPRN |
| Ga0126320_15059821 | 3300010146 | Soil | MSKGKQPRTRVKVPKLLLSEIKKVFIQADKEMGLEAAIIQRSRNRALVNF* |
| Ga0126372_100029052 | 3300010360 | Tropical Forest Soil | MSKGKQPRTRVNKVPKLLLSEIKEVFILYDQEIGLEAAIF*RPRNRALV* |
| Ga0126355_11514882 | 3300010855 | Boreal Forest Soil | MSKGKQPRTRVNKVPKFLLSEIKAVFIPNGQAIGLEAVIC* |
| Ga0126358_11968161 | 3300010856 | Boreal Forest Soil | MSKGKQPRTRVKVPKLLSSEIKKVFIQVDKEMGLEAAII* |
| Ga0126349_12876491 | 3300010861 | Boreal Forest Soil | MSKGKQP*TRVNKVPKLLLSEIKVVFIVYDQEIGLEAAIF*RPR |
| Ga0126348_11967272 | 3300010862 | Boreal Forest Soil | MSKGKQPRTRVNKVPKFLLSEIKAVFIPIGQGIGLEAAIF* |
| Ga0126357_10317231 | 3300010864 | Boreal Forest Soil | CMSKGKQPRTSVKVPKLLLSEIKVVCILHDQEIGLVASIF* |
| Ga0126357_10551711 | 3300010864 | Boreal Forest Soil | MSKGKQPKTIVNKVPKFLLSEIKVVISKINQEMSLEAAIF* |
| Ga0126357_12047191 | 3300010864 | Boreal Forest Soil | MSKGKQPRTRVNKVPKLLLSEIKAVVILTDQEMGLEAAIF* |
| Ga0126347_10335981 | 3300010867 | Boreal Forest Soil | MSKGKQPRTRVKVPKLLLSELKKVFISVNKKMGLGAAII* |
| Ga0138112_10809181 | 3300010905 | Grasslands Soil | MSRGKQPRTSVKVPKLLLSEKEKVFCKYNQEIGLEAAIFSRSRNRAL |
| Ga0138321_104053822 | 3300010980 | Fungi-Associated Bovine Rumen | MSKGKQPRTKVKVPKLLLSEIKKVFIKVDKEIGLEAAIIL* |
| Ga0150983_132672191 | 3300011120 | Forest Soil | MSKGKQPRTRVNKVPKLLLSEIKEVFIIFAQEIGLEAAIF* |
| Ga0150983_136977641 | 3300011120 | Forest Soil | KQPRTRVNKVPKLLLSENKVVFLLFGQEIGLEAAIF* |
| Ga0151652_139503861 | 3300011340 | Wetland | MSKGKQPRTRVNKVPKLLLSENKEVIIVYNQGMGLEAAIF* |
| Ga0151147_11473192 | 3300011426 | Elk Feces | MSKGKQPRTRVKVPKLLLSEIKKVFIKVDKKMGLEAAII* |
| Ga0137455_10270071 | 3300011429 | Soil | MSKGKQPRTRVKVPKLLLSEIKEVFFKYNQEIGLEAAIF* |
| Ga0150985_1179103661 | 3300012212 | Avena Fatua Rhizosphere | MSKGKQPRTSVKVPKLLLSENKEVFKQYNQEIGLEAAIFLKTS* |
| Ga0150985_1215823712 | 3300012212 | Avena Fatua Rhizosphere | MSKGKQPRTSVKVPKLLLSEIKIVFKIVDKEIGLEAAII* |
| Ga0134034_12053161 | 3300012375 | Grasslands Soil | MSKGKQP*TRVNKVPKLLLSEIKEVFMQYDQEIGLEAAIF*RSRNRALI |
| Ga0134025_11939851 | 3300012378 | Grasslands Soil | MSRGKQPRTSVKVPKLLLSEKEKVFCKYNQEIGLEAAIFSRSRNRALVCFLIKLKK* |
| Ga0134026_12103721 | 3300012381 | Grasslands Soil | MSKGKQPRTRVKVPKLLLSEMKEVFFENNQEIGLEAAIF* |
| Ga0134023_10381721 | 3300012385 | Grasslands Soil | CMSKGKQPRTRVNKVPKLLLSENKVVFLLFGQEIGLEAAIF* |
| Ga0134054_11099331 | 3300012390 | Grasslands Soil | MSKGKQPRTRFKVPKLFLSEIKKVFIKVDKKMGLEAAIIL* |
| Ga0150984_1027292021 | 3300012469 | Avena Fatua Rhizosphere | MSKGKQPRTSVKVPKLLLSENKEVFKQYNQEIGLEAAIF* |
| Ga0150984_1053532301 | 3300012469 | Avena Fatua Rhizosphere | MSKGKQPRTRVNKVPKLLLSEIKEVFIIYDQEIGLEAATF* |
| Ga0129353_15878091 | 3300012525 | Aqueous | MSKGKQPRARVNKVPKLLLSEIKAVFILNGQEIGLEAATY* |
| Ga0157216_1000344517 | 3300012668 | Glacier Forefield Soil | MSKGKQP*TRVNKVPKLLLSEIKEVFVLYEKEIGLEAAIYLKIS* |
| Ga0138289_11166531 | 3300012763 | Freshwater Lake | MSKGKQPRTRVNKVPKLLLSEIKAVFILNSQVIGLES |
| Ga0170682_10308371 | 3300013024 | Rock | KGKQPRTRVNKVPKLLLSERKEVFVLFVQEMGLEAATF* |
| Ga0157375_100525192 | 3300013308 | Miscanthus Rhizosphere | MSKGKQPRTSVKVPKFLLSESKEVFKLYNQEIGLEAAIF* |
| Ga0181449_1057101 | 3300013861 | Clean Room | MSKGKQPRTRANKVPKLLLSEFKGVIILYNQGIGLEAAIF* |
| Ga0181471_1026851 | 3300013865 | Clean Room | MSKGKQPRTRANKVPKLLLSEIKEVIIQYVQGIGLEAAIF* |
| Ga0182001_101553481 | 3300014488 | Soil | MSKGKQPRTKVKVPKLLLSETKKVYIYVNKRIGLEAAII* |
| Ga0182024_116235362 | 3300014501 | Permafrost | MSKGKQPRTRVNKVPKLLLSEIKAVFIPNGQEIGLEAAIY* |
| Ga0182185_100008213 | 3300015349 | Switchgrass Phyllosphere | MSKGKQPRTRVNKVPKLLLSEIKDVFILYDQEIGLGAAIF* |
| Ga0182214_10690731 | 3300017440 | Switchgrass Phyllosphere | MSKGKQPRTRVNKVPKLLLSEIKVVTIKSGQEVGLEAAIFL |
| Ga0187806_11397681 | 3300017928 | Freshwater Sediment | MSKGKQPRTRVKVPKLLLSEIKDVFFQNNQEIGLEAAIF |
| Ga0187781_100385281 | 3300017972 | Tropical Peatland | MSKGKQPRTRVKVPKLLLSEIKKVFILVDKEMGLEAAIN |
| Ga0187890_100392166 | 3300018044 | Peatland | MSKGKQPRTKVKVPKLLLSENKKVIIKVNKGMGLEAAIF |
| Ga0194135_101042121 | 3300018414 | Watersheds | MSKGKQPRTRVKVPKLLSSEIKKVIIQVDKEIGLEAAIIQRPRNRALVNL |
| Ga0194135_106449291 | 3300018414 | Watersheds | MSKGKQPRTRVKVPKLMLSEIKEVFIQYNQEMGLEAAIF |
| Ga0194135_109678851 | 3300018414 | Watersheds | MSKGKQPRTRVNKVPKSLLSEMKVVFVRYAQGIGLE |
| Ga0193087_101290411 | 3300018964 | Marine | MSKGKQPRTRVKVPKLLLSENKKVFIYVDKEMGLEAAIIQ |
| Ga0193578_1003052 | 3300019090 | Marine | MSKGKQPRTRVNKVPKLLLSEIKAVFILNSQAIGLESANF |
| Ga0184568_1147191 | 3300019155 | Soil | MSKGKQPRTRVNKVPKLLLSEIKAVVILPDQEIGLEAAIF |
| Ga0184603_1350511 | 3300019192 | Soil | MSKGEYPRTKVKVPKLLLSDKKEVLILFNQEMGLPAAIF |
| Ga0179955_11501721 | 3300019203 | Anaerobic Digestor Sludge | MSKGKQPKTSIKVPKLLLSEIKEVFFKYDQEIGLEAAIF |
| Ga0179956_11284241 | 3300019227 | Anaerobic Digestor Sludge | MSKGKQPKTSIKVPKLLLSEIKEVFFKYDQEIGLEAAIFKDLVTEH |
| Ga0181510_13245241 | 3300019240 | Peatland | MSKGKQPRTRVKVPKLLLSEIKKVFIYVDKIIGLEAAII |
| Ga0187793_11749861 | 3300019241 | Peatland | MSKGKQPRTKVKVPKLLLSENKKVFIKVDKGMGLEAAIF |
| Ga0187793_12994351 | 3300019241 | Peatland | MSKGKQPKTKVKVPKLLLSEIKKVFIKVNKEMGLEAAIF |
| Ga0184648_13158341 | 3300019249 | Groundwater Sediment | MSKGKQPRTSIKVPKLLLSEIKKVIILTDKEIGLEAAII |
| Ga0181504_12090911 | 3300019258 | Peatland | MSKGKQPRTKVKVPKLLLSEIKKVFIRADKEMGLEAAIIXRPRNRALVKSI |
| Ga0184646_12466401 | 3300019259 | Groundwater Sediment | MSKGKQPRTRVNKVPKLLLSEIKEVFDKYNQEIGLEAAIF |
| Ga0187796_13698641 | 3300019264 | Peatland | MSKGKQPRTKIKVPKLFLSEIKKVFIKVDKEMGLEAAKF |
| Ga0181512_14014001 | 3300019270 | Peatland | MSKGKQPRTNVKVPKLLLSESKKVFRYIDKVIGLEAAII |
| Ga0193696_10123021 | 3300020016 | Soil | MSKGKQPRTRVNKVPKLLLSEIKEVFILYDQEIGLEAAIF |
| Ga0206349_14514271 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKGKQPRTKVKVPKLLLSEIKDVFFLNNQEIGLEAAIF |
| Ga0206354_112330211 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKGKQPRTRVKVPKLLLSEIKDVFFKNNQEIGLEAAIF |
| Ga0196958_104075081 | 3300020181 | Soil | MSKGKQPRTRVKVPKLLLSEIKKVFIEVDKRIGLEAAII |
| Ga0210403_101898401 | 3300020580 | Soil | MSKGKQPRTRVKVPKLLLSEIKEVFIVYDQEIGLEAAIF |
| Ga0214277_102519065 | 3300020818 | Food Waste | MSKGKQPRTRVKVPKLLLSEIKKVFIKVNKEIGLEAA |
| Ga0210400_100188441 | 3300021170 | Soil | MSKGKQPRTRVSKVPKLLLSEIKEVFTVYDQEIGLEAAIF |
| Ga0210354_10078832 | 3300021276 | Estuarine | MSKGKQPRTRFKVPKLFLSEIKKVFIKVDKKIGLEAAIIL |
| Ga0206694_10648222 | 3300021291 | Seawater | MSKGKQPRTRVKVPKLLLSEIKVVFFKYNQEIGLEAAIF |
| Ga0213881_102008241 | 3300021374 | Exposed Rock | MSKGKQPRTRVNKVPKLLLSEIKEVIISLGQEVGLGAAIF |
| Ga0213876_100470801 | 3300021384 | Plant Roots | MSKGKQPRTKVKVPKLLLSEFKKVFIKVNKEMGLEAAIF |
| Ga0126371_114726712 | 3300021560 | Tropical Forest Soil | MSKGKQPRTRVKVPKLLLNEIKKVFIRVEKEMGLEAAIF |
| Ga0213854_11215861 | 3300021855 | Watersheds | MSRGKQPETRVNKVPKFLLSEIKGVFILNGQGIGLEAVTF |
| Ga0213849_10819911 | 3300021857 | Watersheds | MSKGKQPKTNVKVPKLLLSEKKDVLYLNYQGIGLEAAIF |
| Ga0213849_11525621 | 3300021857 | Watersheds | MSKGKQPRTRVKVPKLLLSEIKDVFFKNNQEIGLEAAIFXRPRNR |
| Ga0213852_13748871 | 3300021858 | Watersheds | TRVNKVPKSLLSEIKEVFILNGQEIGLEAVIFXRSRNRALVLFLITK |
| Ga0213853_105001351 | 3300021861 | Watersheds | MSKGKQPKTIVNKVPKLLLSEIKVVISKINQEMSLEA |
| Ga0213848_10888081 | 3300021967 | Watersheds | GKQPRTRVNKVPKLFLSEIKEVTFKRDQGIGLEAAISXRSRNRALVNLTFRLNIDKIYQS |
| Ga0213931_10065141 | 3300022161 | Freshwater | MSKGKQPRTKVKVPKLLLSEIMIVFIKVDKDIGLEAATI |
| Ga0242663_10328231 | 3300022523 | Soil | MSKGKQPRTCVKVPKLLLSEIKDVFFKNNQEIGLEAAIF |
| Ga0193714_10000059 | 3300023058 | Soil | MSKGKQPRTRVIKVPKLLLSEIKEVFIVYDQEIGLEAAIFXRPRNRALV |
| Ga0233335_10044301 | 3300023063 | Leaf Litter | MSKGKQPRTRVNKVPKLLLSEIKAVFIPSGQGIGLEAAIF |
| Ga0233335_10691761 | 3300023063 | Leaf Litter | MSKGKQPRTRTNKVPKLLLSEIKEVIIKYVQGIGLEAAIFXRS |
| Ga0224551_10115711 | 3300023259 | Soil | MSKGKQPRTRVNKVPKLLLSEKKVVFLIFGQEIGLEAAIF |
| Ga0247798_10038071 | 3300023260 | Soil | MSKGKQPRTRVKVPKLLLSEIKVVFILFGQEMGLGAAIF |
| Ga0256703_102539363 | 3300023291 | Food Waste | MSKGKQPRTRVKVPKLLLSEIKKVFIKVNKEIGLEAAII |
| Ga0247537_1013041 | 3300023533 | Soil | MSKGKQPRTNVKVPKLLLSESKKVFRYIDKGIGLEAAII |
| Ga0247538_1017381 | 3300023678 | Soil | MSKGKQPRTRVNKVPKLLLSEIKAVFIPNGQEIGLEAATY |
| Ga0228706_10432051 | 3300023697 | Freshwater | MSKGKQPRTRVKVPKLLLSEIKKVFIQVDKEMGLEAAIIQRPRNRALVNF |
| Ga0233359_10331221 | 3300024049 | Soil | MSKGKQPRTRVNKVPKLLLSEIKVVVILTDQEMGLEAAIF |
| Ga0255059_101791071 | 3300024486 | Rumen | MSKGKQPRTRVKVPKLLLSENKKVFIYVDKEMGLEAAIIQXFRNRALVKFF |
| Ga0207696_10562551 | 3300025711 | Switchgrass Rhizosphere | MSKGKQPRTSVKVPKFLLSESKEVFKLYNQEIGLEAAIF |
| Ga0210040_105668301 | 3300025875 | Groundwater | CMSKGKQPRTRVNKVPKLLLSEIKEVFIEYDQEIGLEAAIF |
| Ga0209155_10611131 | 3300026316 | Soil | MSKGKQPRTRVNKVPKLLLSEIKEVFIVYNQEIGLEAAIF |
| Ga0209801_10686791 | 3300026326 | Soil | MSKGKQPRTRVKVPKLLLSEIKKVFIQVDKEMGLEAAIIQ |
| Ga0209378_11297131 | 3300026528 | Soil | MSKGKQPRTRVKVPKLLLNEIKKVFYKVDKDIGLEAAII |
| Ga0209110_100000448 | 3300027002 | Forest Soil | MSKGKQPRTNVKVPKLLLSESKKVFRYINKGIGLEAAII |
| Ga0209111_10010451 | 3300027058 | Forest Soil | MSKGKQPRTRVNKVPKLLLSEIKVVFILFGQEMGLEAAIFLRPRKRALV |
| Ga0208996_10234201 | 3300027257 | Forest Soil | MSKGKQPRTRVNKVPKLLLSEIKAVFIEYDQEIGLEAAIF |
| Ga0209216_10306541 | 3300027530 | Forest Soil | MSKGKQPRTRVKVPKLLLSEIKKVFIQVDKEMGLEAAIIQRSRNR |
| Ga0214469_11187851 | 3300027636 | Soil | MSKGKQPRTRVKVPKLLLSEIKDVSFKNNQEIGLEAAIF |
| Ga0209795_100704501 | 3300027718 | Agave | MSKGKQPRTRVNKVPKLLLSEIKVVFILFTQEIGLEAAIFLRSRNRALINLRIKASKI |
| Ga0209772_100398464 | 3300027768 | Bog Forest Soil | MSKGKQPRTRVNKVPKLFLSENKVVFLLFGQEIGLE |
| Ga0209755_106514991 | 3300027864 | Termite Gut | MSRGKQPRTRFKVPKLLLSEIKKVPRSVGKGIGLEAAIA |
| Ga0268347_100001019 | 3300028142 | Phyllosphere | MSKGKQPRTRVNKVPKLLLSEIKDVFILYDQEIGLGAAIF |
| Ga0265334_1000460412 | 3300028573 | Rhizosphere | MSKGKQPRTKVKVPKLLLSENKKVYKYVDKVVGLEAAII |
| Ga0265798_1005607011 | 3300028586 | Plant Litter | MSKGKQPRTRVNKVPKLLLSEIKVVSIEYDQEVGLEAAIFLRSRNRALVYKLS |
| Ga0265798_101814271 | 3300028586 | Plant Litter | MSKGKQPRTRVNKVPKLLLSEIKEVVISYGQLIGLEAANFXXSRNRALVN |
| Ga0307517_101810331 | 3300028786 | Ectomycorrhiza | MSKGKQPRTRVNKVPKLLLSEIKEVFIIFAQEIGLEAAIF |
| Ga0308309_107686751 | 3300028906 | Soil | MSKGKQPRTRVNKVPKLLLSEIKEVFIVYDQEIGLEAAIF |
| Ga0311341_100333252 | 3300029908 | Bog | MSKGKQPRTRANKVPKLLLSEIKEVIIIYVQEIGLEAAIF |
| Ga0311338_102969783 | 3300030007 | Palsa | MSKGKQPRTMVNKVPKLLLSEIKVVVILIDQEMSLEAAIF |
| Ga0268246_1000050211 | 3300030495 | Agave | MSKGKQPRTRVKVPKLLLSENKEVFFKSNQEIGLEAAIF |
| Ga0268246_100704661 | 3300030495 | Agave | MSKGKQPRTSNNKVPKLLLSEIKEVIIKDDQGIGLEAAIF |
| Ga0268247_100064111 | 3300030498 | Agave | MSKGKQPRTRVNKVPKLLLSEIKEVIIKYVQGIGLEAAIF |
| Ga0268244_100044101 | 3300030501 | Agave | MSKGKQPRTRVKVPKLLLSENKEVFFKYNQEIGLEAAIF |
| Ga0268244_100126962 | 3300030501 | Agave | MSKGKQPRTSNNKVPKLLLSEIKEVIIKYDQGIGLEAAIF |
| Ga0268244_101927851 | 3300030501 | Agave | MSKGKQPRTSINKVPKLLLSEIKEVVIKYDQGIGLEAAIF |
| Ga0268244_108436901 | 3300030501 | Agave | MSKGKQPRTRVKVPKLLLSENKEGFFEYNQEIGLEAAIFXR |
| Ga0268245_100064892 | 3300030505 | Agave | MSKGKQPRTRVKVPKLLLSENKEGFFEYNQEIGLEAAIF |
| Ga0307511_101086121 | 3300030521 | Ectomycorrhiza | MSKGKQPRTRVNKVPKLLLSEIKEVFIIFAQEIGLEA |
| Ga0247652_10219851 | 3300030571 | Soil | MSKGKQPRTRVKVPKLLLSEIKVVFFKYNQEIGLEA |
| Ga0247648_10564361 | 3300030574 | Soil | MSKGKQPRTRVKVPKLLLSEIKKVFISGNNKMGLEAATI |
| Ga0210263_10841371 | 3300030593 | Soil | MSKGKQPRTRVNKVPKLFSSEIKVVGVQNGKEVGLEAVNILRNS |
| Ga0247636_102679571 | 3300030634 | Soil | SKGKQPRTSVKVPKLLLSEIKKVFIQVDKEMGLEAAIIQRPRNRALVNF |
| Ga0268250_101287081 | 3300030692 | Agave | MSKGKQPRTRANKVPKLLLSEIKEVIIKYVQGIGLEAAIF |
| Ga0074008_100751641 | 3300030754 | Soil | MSKGKQPRTRVNKVPKLLLSENKEVFIQYTQEIGLEAAIF |
| Ga0074008_110034391 | 3300030754 | Soil | MSKGKQPRTRVNKVPKLLLSEIKVVFILFDQEIGLGAAIF |
| Ga0138305_15580652 | 3300030758 | Soil | MSKGKQPRTRVKVPKLLLSEIKEVFFKYNQEIGEDGG |
| Ga0315877_1256111 | 3300030768 | Plant Litter | MSKGKQPRTRVNKVPKLLLSEIKEVVISYGQLIGLEAANF |
| Ga0102757_100198531 | 3300030785 | Soil | MSKGKQPRTIVYKVPKLLLSEIKVVIILIDQEMSLEAAIF |
| Ga0265786_1112841 | 3300030810 | Plant Litter | KQPRTRVNKVPKLLLSEIKVVFTPPDQEIGLGAAIF |
| Ga0315851_1077891 | 3300030822 | Plant Litter | MSKGKQPTTRVNKVPKLLLSEIKEVVISYGQLIGLEAANFXXSRNRALVN |
| Ga0315871_1052911 | 3300030827 | Plant Litter | MSKGKQPRTRVNKVPKLLLSENKAVSIESDQEVGLEAAIFLRPRNRALVYKTR |
| Ga0315868_1028511 | 3300030837 | Plant Litter | MSKGKQPRTRVNKVPKLFLSEKKVVIIKYNQEIGLEAAIFLRTRNRALVYKLS |
| Ga0074020_109514091 | 3300030840 | Soil | MSKGKQPRTIIYKVPKLLLSEIKVVIILIDQEMSLEAAIF |
| Ga0075380_100029641 | 3300030851 | Soil | MSKGKQPRTKVKVPKLILSESKKVLIQVDKEMGLEAARIQRSRNRALVNL |
| Ga0315875_1080661 | 3300030890 | Plant Litter | MSKGKQPRTRVNKVPKLFLSEKKVVIIKYNQEIGLEAAIF |
| Ga0315884_1063211 | 3300030894 | Plant Litter | MSKGKQPRTKVKVPKLLLSEIKRVFIKVDKEIGLEAAII |
| Ga0315884_1203601 | 3300030894 | Plant Litter | GKQPRTRVNKVPKLLLSEIKVVFTPPDQEIGLGAAIF |
| Ga0315889_1220761 | 3300030897 | Plant Litter | GKQPRTRANKVPKLLLSEIKEVIIKYVQGIGLEAAIF |
| Ga0315876_1056791 | 3300030901 | Plant Litter | MSKGKQPRTRVNKVPKLFLSEKKVVIIKYNQEIGLEAAIFLRTRNRALVSDIS |
| Ga0308202_10088481 | 3300030902 | Soil | MSKGKKPRTRVKVPKLLLSENKKVFIYVDKEMGLEAAIIQ |
| Ga0308200_10881662 | 3300030905 | Soil | MSKGKQPRTRFKVPKLFLSEIKTVSNQDDKKMGLEAAKIL |
| Ga0061011_119982451 | 3300030915 | Fungi-Associated Bovine Rumen | MSKGKQPRTKVKVPKLLLSEIKKVFIKVDKEIGLEAAIIL |
| Ga0138300_14691081 | 3300030922 | Soil | MSKGKQPRTRVKVPKLLLSEIKKVFIQVDKEMGLEAAIIQRYRNRALVNL |
| Ga0102745_18460021 | 3300030960 | Soil | MSKGKQPRTRVKVPKLLFSEIKKVFIKVDKEIGLEAAIIL |
| Ga0138297_16723521 | 3300030962 | Soil | MSKGKQPRANVKVPKLLLSESKKVFRYIDKGIGLEAAII |
| Ga0308183_11248321 | 3300030988 | Soil | MSKGKQPRTRVKVPKLLLSEIKDVLYLNYQEIGLEAAIF |
| Ga0308190_10005901 | 3300030993 | Soil | MSKGKQPRTRVNKVPKLLLSEIKVVSTEYDQEVGLEAAIFLRSRNRALVYK |
| Ga0308190_11000221 | 3300030993 | Soil | CMSRGKQPRTSVKVPKLLLSEKEKVFCKYNQEIGLGAAIF |
| Ga0315887_1015821 | 3300031012 | Plant Litter | MSKGKQPTTRVNKVPKLLLSEIKEVVISYGQLIGLEAANF |
| Ga0102765_101210121 | 3300031021 | Soil | MSKGKQPRTKVKVPKLLLSENKKVCIQVDKGIGLEAAII |
| Ga0102765_116114281 | 3300031021 | Soil | MSKGKQPRTSVNKVPKLILSEIKEVVIKYDQGIGLEAAIF |
| Ga0170834_1035895511 | 3300031057 | Forest Soil | GKQPXTKVNKVPKLLLSEIKVVFILFDQEVSLEAAIF |
| Ga0170834_1121922991 | 3300031057 | Forest Soil | MSKGKQPRISVKVPKLLLSEKKDVFIAVDKGMGLEAAIIXRSRNRALINF |
| Ga0308189_100054521 | 3300031058 | Soil | MSRGKQPRTSVKVPKLLLSEKEKVFCKYNQEIGLEAAIFSRSRNRALVCFLIELKK |
| Ga0308189_101001131 | 3300031058 | Soil | RTKVKVPKLLLSEIKKVFIXVDKEMGLEAAIIXRPRNRALVKSLKASKI |
| Ga0308192_10092411 | 3300031082 | Soil | MSKGKQPRTRVKVPKLLLSENKKVFIYVDKEMGLEAAIIQRPRNRALVNF |
| Ga0308201_101282351 | 3300031091 | Soil | SKGKQPRTSVKVPKLLLSEIKKVFFIYSKEIGLEAAIF |
| Ga0308188_10003451 | 3300031097 | Soil | MSKGKQPRTRVNKVPKLLLSEIKVVSIEYGQEVGLEAAIFLRPRNRALVYKLS |
| Ga0170824_1032109071 | 3300031231 | Forest Soil | MSKGKQPRTRVNKVPKLLLSENKVVFLLFGQEIGLEAAIFLRPRNRALVQLIIIYNILILRKAPKI |
| Ga0170824_1211343341 | 3300031231 | Forest Soil | MSKGKQPRTRVNKVPKLLLSEIKVVFILFGQEMGLEAAIFLRSRKRALI |
| Ga0102761_101661321 | 3300031411 | Soil | MSKGKQPRTIVNKVPKLLLSEIKVVIILIDQEMSLEAAIF |
| Ga0308186_10151321 | 3300031422 | Soil | MSKGKQPRTSVKVPKLLLSEIKVVFILFGQEMGLGAAIF |
| Ga0315835_1000732 | 3300031426 | Plant Litter | MSKGKQPRTRVNKVPKLLLSEIKEVVMXDVQGIGLEAAIF |
| Ga0170820_128228231 | 3300031446 | Forest Soil | RTRVNKVPKLLLSENKVVFLLFGQEIGLEAAIFFKTS |
| Ga0272438_100009565 | 3300031448 | Rock | MSKGKQPKTRANKVPKLLLSEIKEVIIIYDQEIGLGAAIF |
| Ga0272429_10006272 | 3300031449 | Rock | MSKGKQPRTSMNKVPKLLLSEIKEVVIKYDQGIGLEAAIF |
| Ga0272429_12290851 | 3300031449 | Rock | MSRGKQPRTRVNKVPKLLLSEIKEVIIRYAQEIGLEAAIF |
| Ga0272433_1000154734 | 3300031450 | Rock | MSKGKQPRARVNKVPKFLLSEIKAVFTPIGQGIGLEAATI |
| Ga0272433_1000342310 | 3300031450 | Rock | MSKGKQPRTRVNKVPKLLLSENKEVFIQYIQEIGLEAAIFLRPRNRALVKLTFMLLLLL |
| Ga0272422_10402811 | 3300031452 | Rock | MSKGKQPRTRVNKVPKFLLSEMKVVFFQYAQEIGLEAAIF |
| Ga0272425_10032231 | 3300031453 | Rock | MSKGKQPRTRVNKVPKLLLSENKEVFFQYGQEIGLEAAIF |
| Ga0272425_100471424 | 3300031453 | Rock | MSKGKQPRTRVNKVPKLLLSENKEVFIQYIQEIGLEAAIF |
| Ga0272425_10475364 | 3300031453 | Rock | MSKGKQPRTRVNKVPKLLLSEIKAVFIPIDQEIGLEAAIY |
| Ga0272430_100075273 | 3300031460 | Rock | MSKGKQPRTRVNKVPKLLLSEIKAVFIPIDQEIGLEAAIYXRPRNRALVLFVYQRLYG |
| Ga0265785_1110321 | 3300031501 | Plant Litter | SKGKQPRTRVNKVPKLLLSEIKVVFTPPDQEIGLGAAIF |
| Ga0272428_10440644 | 3300031520 | Rock | MSKGKQPKTRANKVPKLLLSEIKEVIIIYDQGIGLGAAIF |
| Ga0272428_11827071 | 3300031520 | Rock | MSRGKQPRTRVNKVPKLLLSEIKEVFIRYDQEIGLEAAIF |
| Ga0316037_1037971 | 3300031808 | Soil | MSKGKQPRTKVKVPKLFLSEIKIIFIIIGKNIGLESAIV |
| Ga0316042_1186481 | 3300031816 | Soil | MSKGKQPRTRVKVPKLLLSEIKKVFISVNKKMGLGAAIILRFRSRALVTL |
| Ga0247536_1017412 | 3300032027 | Soil | MSKGKQPRTRVNKVPKLLLSEIKAVFIPNGQEIGLEAATF |
| Ga0268251_100595242 | 3300032159 | Agave | MSKGKQPRTRVKVPKLMLSESKEVFFKYNQEIGLEAAIF |
| Ga0214492_10886491 | 3300032464 | Switchgrass Phyllosphere | MSKGKQPRTRVNKVPKLILSEIKGVIIQYNQGIGLEAAIF |
| Ga0214493_10364821 | 3300032465 | Switchgrass Phyllosphere | KGKQPRTRVKVPKLLLSEIKVVFFKYNQEIGLEAAIF |
| Ga0214488_11346231 | 3300032467 | Switchgrass Phyllosphere | MSKGKQPRTRVNKVPKLLLSEKKEVVISYGQLIGLEAANL |
| Ga0214491_11347721 | 3300032469 | Switchgrass Phyllosphere | MSKGKQPRTRVNKVPKLLLSEKKEVVISYGQLIGLEAANFXXSRNRALVN |
| Ga0214502_10010653 | 3300032514 | Switchgrass Phyllosphere | MSKGKQPRTRVKVPKLLLSENKKVFIYVDKEMGLEAAIIQXFRNRALVKFFKGIEIQRI |
| Ga0348332_126489071 | 3300032515 | Plant Litter | CMSKGKQPRTRVNKVPKLLLSEIKEVVILTDQEMGLEAAIF |
| Ga0214501_11357981 | 3300032625 | Switchgrass Phyllosphere | MSKGKQPRTKVKVPKLLLSEIKKVFIXVDKEMGLE |
| Ga0314753_10577171 | 3300032757 | Switchgrass Phyllosphere | MSKGKQPRTRVKVPKLLLSEIKEVFFVNNQEIGLEAAIFXRSRNRALVNSHFERKDEVKG |
| Ga0314753_10781991 | 3300032757 | Switchgrass Phyllosphere | KQPRTRVNKVPKLLLSEIKVVTIKSGQEVGLEAAIFLRSRNRALVYKLS |
| Ga0314746_10469722 | 3300032758 | Switchgrass Phyllosphere | MSKGKQPRTRVNKVPKLLLSEIKAVFILYDQEIGL |
| Ga0314746_10728801 | 3300032758 | Switchgrass Phyllosphere | GCMSKGKQPRTRVNKVPKLLLSEIKAVFILYDQEIGLGAAIF |
| Ga0314754_10289411 | 3300032760 | Switchgrass Phyllosphere | MSKGKQPRTRVNKVPKLLLSEIKAVFILYDQEIGLGAAIF |
| Ga0314733_11038281 | 3300032761 | Switchgrass Phyllosphere | MSKGKQPRTRVNKVPKLLLSEIKEVVISYGQLIGLEAANL |
| Ga0335082_1001817615 | 3300032782 | Soil | MSKGKQPRTRVKVPKLLLSEIKKVLIQVDKGIGLEAAIT |
| Ga0314725_10010421 | 3300032789 | Switchgrass Phyllosphere | MSKGKQPRTRVKVPKLMLSEIKEVFIIYNQEIGLEAAIF |
| Ga0314745_10710871 | 3300032812 | Switchgrass Phyllosphere | MSKGKQPRTRVNKVPKLLLSEKKEVVILYVQLIGLEAANF |
| Ga0314737_10891981 | 3300032875 | Switchgrass Phyllosphere | MSIGKQPNTSEYKVPKLLLSEIKDVVIKYNQEIGLEAAIF |
| Ga0314751_10386911 | 3300032889 | Switchgrass Phyllosphere | MSKGKQPRTRVKVPKLLLSEIKKVFIQVDKEIGLEAAIIQRPRNRALVNFLKASKI |
| Ga0314749_10969962 | 3300032915 | Switchgrass Phyllosphere | MSKGKQPRTRVNKVPKLLLSEIKVVFIQFAQEIGLGA |
| Ga0314734_10789401 | 3300032916 | Switchgrass Phyllosphere | KQPRTKVKVPKLLLSEIKKVFIXVDKEMGLEAAIIXRPRNRALVKSLKASKI |
| Ga0335083_110293721 | 3300032954 | Soil | MSKGKQPRTKVKVPKLLLSENKKVFIKVNKGMGLE |
| Ga0314738_10424891 | 3300032959 | Switchgrass Phyllosphere | YDKVVCLKGNSPKTRANKVPKLLLSEKKEVVISYGQLIGLEAANL |
| Ga0335077_1000185031 | 3300033158 | Soil | MSKGKQPRTIVIKVPKLLLSEIKEVFIVYDQEIGLEAAIFXRPRNRALV |
| Ga0272431_102430682 | 3300033181 | Rock | MSKGKQPRTRVKVPKLLLSEIKEVFKRYDEEIGLEAAIF |
| Ga0314768_10511441 | 3300033523 | Switchgrass Phyllosphere | MSKGKQPRTRVNKVPKLLLSEIKVVTIKSGQEVGLEAAIFLRPRNRALVYKIEAPKI |
| Ga0316588_10403222 | 3300033528 | Rhizosphere | MSKGKQPRTRFKVPKLFLSEIKTVFIQPDKKIGLEAAIIL |
| Ga0314760_10043001 | 3300033530 | Switchgrass Phyllosphere | MSKGKQPRTKVNKVPKLLLSEIKKVVILFDQEIGLGAAIF |
| Ga0314760_10521921 | 3300033530 | Switchgrass Phyllosphere | MSKGKQPRTRINKVPKLLLSENKEVFFKYNQEIGLEAAI |
| Ga0314762_11116111 | 3300033539 | Switchgrass Phyllosphere | CMSKGKQPRTRVNKVPKLLLSENKEVPIESGQEVGLEAAIF |
| Ga0314764_10320331 | 3300033540 | Switchgrass Phyllosphere | GKQPRTRVNKVPKLLLSEIKVVFILFAQEIGLGAAIF |
| Ga0314765_10331741 | 3300033543 | Switchgrass Phyllosphere | MSKGKQPRTKVNKVPKLLLSEIKVVSNEYGQEVGLEAAIF |
| ⦗Top⦘ |