| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001709 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0067852 | Gp0056770 | Ga0006056 |
| Sample Name | Marine viral communities from the Pacific Ocean - LP-29 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 40318590 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 48.9698 | Long. (o) | -130.6666 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013050 | Metagenome / Metatranscriptome | 275 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI24509J20081_1000495 | Not Available | 9130 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI24509J20081_1000495 | JGI24509J20081_10004952 | F013050 | MSKGKQPRTRVKVPKLLLSEIKDVFFQNNQEIGLEAAIF* |
| ⦗Top⦘ |