| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008686 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118005 | Gp0126693 | Ga0104245 |
| Sample Name | Food microbial communities from the fermentation process of Kimchi from South Korea - J7 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Chung-Ang Univiersity |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 28694776 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Food Microbial Communities From The Fermentation Process Of Kimchi From South Korea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Fermented Vegetables → Food Microbial Communities From The Fermentation Process Of Kimchi From South Korea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South Korea | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013050 | Metagenome / Metatranscriptome | 275 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0104245_1002726 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | 653 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0104245_1002726 | Ga0104245_10027262 | F013050 | MSKGKQPRTRVKVPKLLLSENKEVFFKYNQEIGLEAAIF* |
| ⦗Top⦘ |