| Basic Information | |
|---|---|
| Family ID | F004178 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 449 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MRSRTSHAAKSGVGEHTARESECAQRVRRERARGERPP |
| Number of Associated Samples | 272 |
| Number of Associated Scaffolds | 449 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 96.21 % |
| % of genes near scaffold ends (potentially truncated) | 99.78 % |
| % of genes from short scaffolds (< 2000 bps) | 99.78 % |
| Associated GOLD sequencing projects | 264 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.797 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.849 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.053 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.356 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 449 Family Scaffolds |
|---|---|---|
| PF05943 | VipB | 0.22 |
| PF13620 | CarboxypepD_reg | 0.22 |
| PF00270 | DEAD | 0.22 |
| PF02875 | Mur_ligase_C | 0.22 |
| PF01012 | ETF | 0.22 |
| COG ID | Name | Functional Category | % Frequency in 449 Family Scaffolds |
|---|---|---|---|
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.22 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.22 |
| COG3517 | Predicted component TssB of the type VI protein secretion system, VipA/VipB/TssB family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.22 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.80 % |
| All Organisms | root | All Organisms | 41.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002647|Ga0005469J37257_100963 | Not Available | 674 | Open in IMG/M |
| 3300004121|Ga0058882_1028650 | Not Available | 776 | Open in IMG/M |
| 3300004600|Ga0068964_1024843 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 676 | Open in IMG/M |
| 3300004614|Ga0068956_1015328 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 835 | Open in IMG/M |
| 3300005646|Ga0075040_1082676 | Not Available | 661 | Open in IMG/M |
| 3300006426|Ga0075037_1085872 | Not Available | 808 | Open in IMG/M |
| 3300006861|Ga0063777_1002567 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
| 3300007327|Ga0075016_1086374 | Not Available | 815 | Open in IMG/M |
| 3300008785|Ga0103638_1000630 | Not Available | 826 | Open in IMG/M |
| 3300009218|Ga0103848_1053552 | Not Available | 790 | Open in IMG/M |
| 3300009221|Ga0103849_1026519 | Not Available | 761 | Open in IMG/M |
| 3300009233|Ga0103856_10042815 | Not Available | 795 | Open in IMG/M |
| 3300009235|Ga0103857_10055717 | Not Available | 757 | Open in IMG/M |
| 3300009243|Ga0103860_10048657 | Not Available | 838 | Open in IMG/M |
| 3300009247|Ga0103861_10027615 | Not Available | 804 | Open in IMG/M |
| 3300009254|Ga0103867_1014245 | Not Available | 772 | Open in IMG/M |
| 3300009257|Ga0103869_10074957 | Not Available | 808 | Open in IMG/M |
| 3300009257|Ga0103869_10212291 | Not Available | 536 | Open in IMG/M |
| 3300009352|Ga0103865_1004582 | Not Available | 753 | Open in IMG/M |
| 3300009579|Ga0115599_1011563 | Not Available | 805 | Open in IMG/M |
| 3300009580|Ga0115596_1064533 | Not Available | 511 | Open in IMG/M |
| 3300009582|Ga0115601_1004820 | Not Available | 811 | Open in IMG/M |
| 3300009586|Ga0115591_1183077 | Not Available | 684 | Open in IMG/M |
| 3300009755|Ga0115592_1161675 | Not Available | 816 | Open in IMG/M |
| 3300010152|Ga0126318_10065787 | Not Available | 800 | Open in IMG/M |
| 3300010154|Ga0127503_11103245 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 696 | Open in IMG/M |
| 3300010164|Ga0063827_137540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
| 3300010198|Ga0127509_1029021 | Not Available | 812 | Open in IMG/M |
| 3300010305|Ga0129320_124663 | Not Available | 519 | Open in IMG/M |
| 3300010858|Ga0126345_1018053 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
| 3300010858|Ga0126345_1110156 | Not Available | 827 | Open in IMG/M |
| 3300010859|Ga0126352_1083059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
| 3300010862|Ga0126348_1106939 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
| 3300010862|Ga0126348_1232686 | Not Available | 807 | Open in IMG/M |
| 3300010864|Ga0126357_1137853 | Not Available | 548 | Open in IMG/M |
| 3300010865|Ga0126346_1083977 | Not Available | 564 | Open in IMG/M |
| 3300010866|Ga0126344_1223173 | Not Available | 785 | Open in IMG/M |
| 3300010866|Ga0126344_1233064 | Not Available | 826 | Open in IMG/M |
| 3300010876|Ga0126361_10304802 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 786 | Open in IMG/M |
| 3300010876|Ga0126361_11102269 | Not Available | 640 | Open in IMG/M |
| 3300011016|Ga0138589_109547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 602 | Open in IMG/M |
| 3300011019|Ga0138557_102520 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
| 3300011019|Ga0138557_116259 | Not Available | 616 | Open in IMG/M |
| 3300011020|Ga0138602_108064 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
| 3300011023|Ga0138548_108128 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
| 3300011023|Ga0138548_110710 | Not Available | 728 | Open in IMG/M |
| 3300011023|Ga0138548_110958 | Not Available | 780 | Open in IMG/M |
| 3300011023|Ga0138548_118233 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| 3300011025|Ga0138561_122259 | Not Available | 693 | Open in IMG/M |
| 3300011027|Ga0138580_104466 | Not Available | 802 | Open in IMG/M |
| 3300011028|Ga0138577_102864 | Not Available | 654 | Open in IMG/M |
| 3300011028|Ga0138577_122919 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
| 3300011029|Ga0138551_114634 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1111 | Open in IMG/M |
| 3300011034|Ga0138549_101292 | Not Available | 803 | Open in IMG/M |
| 3300011034|Ga0138549_116473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 798 | Open in IMG/M |
| 3300011034|Ga0138549_117267 | Not Available | 598 | Open in IMG/M |
| 3300011040|Ga0138587_145910 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
| 3300011043|Ga0138528_159607 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 792 | Open in IMG/M |
| 3300011047|Ga0138553_149928 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 829 | Open in IMG/M |
| 3300011051|Ga0138540_122401 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
| 3300011053|Ga0138531_134061 | Not Available | 748 | Open in IMG/M |
| 3300011054|Ga0138523_1101319 | Not Available | 776 | Open in IMG/M |
| 3300011059|Ga0138597_1005127 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
| 3300011062|Ga0138582_1011432 | Not Available | 757 | Open in IMG/M |
| 3300011062|Ga0138582_1023592 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
| 3300011063|Ga0138537_1018353 | Not Available | 813 | Open in IMG/M |
| 3300011063|Ga0138537_1039120 | Not Available | 747 | Open in IMG/M |
| 3300011064|Ga0138525_1093821 | Not Available | 687 | Open in IMG/M |
| 3300011064|Ga0138525_1104783 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 823 | Open in IMG/M |
| 3300011065|Ga0138533_1067244 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
| 3300011066|Ga0138524_1136981 | Not Available | 741 | Open in IMG/M |
| 3300011067|Ga0138594_1080808 | Not Available | 606 | Open in IMG/M |
| 3300011068|Ga0138599_1109423 | Not Available | 609 | Open in IMG/M |
| 3300011073|Ga0138584_1050347 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300011074|Ga0138559_1093540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 824 | Open in IMG/M |
| 3300011075|Ga0138555_1031025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 911 | Open in IMG/M |
| 3300011084|Ga0138562_1178487 | Not Available | 805 | Open in IMG/M |
| 3300011085|Ga0138581_1037430 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
| 3300011087|Ga0138570_1101688 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300011088|Ga0138576_1032829 | Not Available | 521 | Open in IMG/M |
| 3300011088|Ga0138576_1234969 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 828 | Open in IMG/M |
| 3300011110|Ga0138578_1040247 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
| 3300011120|Ga0150983_11466887 | Not Available | 805 | Open in IMG/M |
| 3300011120|Ga0150983_16290468 | Not Available | 759 | Open in IMG/M |
| 3300011332|Ga0126317_10017954 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
| 3300011340|Ga0151652_11904248 | Not Available | 676 | Open in IMG/M |
| 3300012212|Ga0150985_117023130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 824 | Open in IMG/M |
| 3300012383|Ga0134033_1188540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 634 | Open in IMG/M |
| 3300012392|Ga0134043_1076495 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
| 3300012411|Ga0153880_1106806 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 772 | Open in IMG/M |
| 3300012411|Ga0153880_1250003 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 913 | Open in IMG/M |
| 3300012411|Ga0153880_1253200 | Not Available | 931 | Open in IMG/M |
| 3300012746|Ga0157556_126740 | Not Available | 813 | Open in IMG/M |
| 3300012747|Ga0157564_1051884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 805 | Open in IMG/M |
| 3300014499|Ga0182012_10701135 | Not Available | 646 | Open in IMG/M |
| 3300016687|Ga0180047_1111520 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 687 | Open in IMG/M |
| 3300016698|Ga0181503_1007977 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 765 | Open in IMG/M |
| 3300016700|Ga0181513_1206319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 812 | Open in IMG/M |
| 3300016701|Ga0181509_1357469 | Not Available | 870 | Open in IMG/M |
| 3300016702|Ga0181511_1031444 | Not Available | 690 | Open in IMG/M |
| 3300016702|Ga0181511_1043065 | Not Available | 808 | Open in IMG/M |
| 3300016702|Ga0181511_1109403 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
| 3300016702|Ga0181511_1166830 | Not Available | 763 | Open in IMG/M |
| 3300016705|Ga0181507_1062455 | Not Available | 533 | Open in IMG/M |
| 3300016705|Ga0181507_1251021 | Not Available | 902 | Open in IMG/M |
| 3300016728|Ga0181500_1045680 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
| 3300016728|Ga0181500_1254327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 809 | Open in IMG/M |
| 3300016728|Ga0181500_1410494 | Not Available | 692 | Open in IMG/M |
| 3300016730|Ga0181515_1071922 | Not Available | 564 | Open in IMG/M |
| 3300016730|Ga0181515_1246584 | Not Available | 560 | Open in IMG/M |
| 3300016750|Ga0181505_10024825 | Not Available | 537 | Open in IMG/M |
| 3300016750|Ga0181505_10084635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1346 | Open in IMG/M |
| 3300016750|Ga0181505_10726370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
| 3300019155|Ga0184568_112999 | Not Available | 809 | Open in IMG/M |
| 3300019158|Ga0184580_103365 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300019158|Ga0184580_111899 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| 3300019159|Ga0184574_117712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
| 3300019159|Ga0184574_123152 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
| 3300019160|Ga0184577_116537 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 665 | Open in IMG/M |
| 3300019162|Ga0184597_129270 | Not Available | 703 | Open in IMG/M |
| 3300019163|Ga0184581_119867 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 783 | Open in IMG/M |
| 3300019164|Ga0184582_100235 | Not Available | 804 | Open in IMG/M |
| 3300019164|Ga0184582_111724 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300019164|Ga0184582_121333 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
| 3300019168|Ga0184569_105181 | Not Available | 767 | Open in IMG/M |
| 3300019168|Ga0184569_111448 | Not Available | 796 | Open in IMG/M |
| 3300019170|Ga0184570_106216 | Not Available | 807 | Open in IMG/M |
| 3300019174|Ga0184579_109683 | Not Available | 641 | Open in IMG/M |
| 3300019176|Ga0184596_110258 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 698 | Open in IMG/M |
| 3300019176|Ga0184596_118195 | Not Available | 714 | Open in IMG/M |
| 3300019177|Ga0184592_118250 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| 3300019178|Ga0184583_110534 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
| 3300019180|Ga0184578_108157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
| 3300019184|Ga0184590_106957 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 817 | Open in IMG/M |
| 3300019186|Ga0184588_117935 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
| 3300019186|Ga0184588_136877 | Not Available | 655 | Open in IMG/M |
| 3300019189|Ga0184585_123849 | Not Available | 671 | Open in IMG/M |
| 3300019189|Ga0184585_141144 | Not Available | 620 | Open in IMG/M |
| 3300019192|Ga0184603_147865 | Not Available | 810 | Open in IMG/M |
| 3300019199|Ga0187789_1333845 | Not Available | 797 | Open in IMG/M |
| 3300019211|Ga0187799_1141280 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
| 3300019230|Ga0181501_1018987 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
| 3300019230|Ga0181501_1384585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 794 | Open in IMG/M |
| 3300019240|Ga0181510_1276757 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 614 | Open in IMG/M |
| 3300019241|Ga0187793_1167339 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300019241|Ga0187793_1174980 | Not Available | 672 | Open in IMG/M |
| 3300019241|Ga0187793_1348328 | Not Available | 813 | Open in IMG/M |
| 3300019242|Ga0181502_1108559 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 630 | Open in IMG/M |
| 3300019242|Ga0181502_1349791 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
| 3300019245|Ga0187791_1191688 | Not Available | 789 | Open in IMG/M |
| 3300019245|Ga0187791_1393609 | Not Available | 739 | Open in IMG/M |
| 3300019250|Ga0187790_1137012 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300019251|Ga0187795_1059139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 810 | Open in IMG/M |
| 3300019251|Ga0187795_1177334 | Not Available | 680 | Open in IMG/M |
| 3300019251|Ga0187795_1244061 | Not Available | 804 | Open in IMG/M |
| 3300019256|Ga0181508_1216049 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 820 | Open in IMG/M |
| 3300019256|Ga0181508_1240837 | Not Available | 800 | Open in IMG/M |
| 3300019256|Ga0181508_1249792 | Not Available | 823 | Open in IMG/M |
| 3300019256|Ga0181508_1317902 | Not Available | 801 | Open in IMG/M |
| 3300019256|Ga0181508_1448385 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 620 | Open in IMG/M |
| 3300019257|Ga0180115_1115773 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 743 | Open in IMG/M |
| 3300019258|Ga0181504_1201307 | Not Available | 541 | Open in IMG/M |
| 3300019258|Ga0181504_1529851 | Not Available | 919 | Open in IMG/M |
| 3300019260|Ga0181506_1141458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1364 | Open in IMG/M |
| 3300019260|Ga0181506_1272739 | Not Available | 548 | Open in IMG/M |
| 3300019265|Ga0187792_1476305 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
| 3300019268|Ga0181514_1233707 | Not Available | 797 | Open in IMG/M |
| 3300019268|Ga0181514_1362078 | Not Available | 825 | Open in IMG/M |
| 3300019270|Ga0181512_1024645 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300019270|Ga0181512_1711077 | Not Available | 759 | Open in IMG/M |
| 3300019270|Ga0181512_1733269 | Not Available | 812 | Open in IMG/M |
| 3300019273|Ga0187794_1108567 | Not Available | 784 | Open in IMG/M |
| 3300019273|Ga0187794_1197532 | Not Available | 722 | Open in IMG/M |
| 3300019273|Ga0187794_1351629 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300019275|Ga0187798_1453589 | Not Available | 810 | Open in IMG/M |
| 3300019275|Ga0187798_1536607 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
| 3300019278|Ga0187800_1217236 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 594 | Open in IMG/M |
| 3300019278|Ga0187800_1397705 | Not Available | 677 | Open in IMG/M |
| 3300019278|Ga0187800_1420601 | Not Available | 548 | Open in IMG/M |
| 3300019278|Ga0187800_1443861 | Not Available | 807 | Open in IMG/M |
| 3300019278|Ga0187800_1611658 | Not Available | 615 | Open in IMG/M |
| 3300020075|Ga0206349_1634318 | Not Available | 503 | Open in IMG/M |
| 3300020076|Ga0206355_1602407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 798 | Open in IMG/M |
| 3300020077|Ga0206351_10408839 | Not Available | 784 | Open in IMG/M |
| 3300020610|Ga0154015_1680831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
| 3300021151|Ga0179584_1387609 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 722 | Open in IMG/M |
| 3300021259|Ga0179581_119731 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
| 3300021307|Ga0179585_1131478 | Not Available | 696 | Open in IMG/M |
| 3300021855|Ga0213854_1024058 | Not Available | 810 | Open in IMG/M |
| 3300021855|Ga0213854_1142579 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 785 | Open in IMG/M |
| 3300021855|Ga0213854_1292236 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
| 3300021858|Ga0213852_1092050 | Not Available | 715 | Open in IMG/M |
| 3300021860|Ga0213851_1542685 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300021860|Ga0213851_1579770 | Not Available | 606 | Open in IMG/M |
| 3300021860|Ga0213851_1827609 | Not Available | 692 | Open in IMG/M |
| 3300021861|Ga0213853_10433272 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
| 3300021861|Ga0213853_11589069 | Not Available | 671 | Open in IMG/M |
| 3300021909|Ga0213846_1013173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
| 3300022147|Ga0213930_118857 | Not Available | 532 | Open in IMG/M |
| 3300022156|Ga0213934_1024010 | Not Available | 812 | Open in IMG/M |
| 3300022467|Ga0224712_10342731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 705 | Open in IMG/M |
| 3300022498|Ga0242644_1005473 | Not Available | 1016 | Open in IMG/M |
| 3300022498|Ga0242644_1010005 | Not Available | 837 | Open in IMG/M |
| 3300022498|Ga0242644_1010981 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| 3300022498|Ga0242644_1011533 | Not Available | 800 | Open in IMG/M |
| 3300022498|Ga0242644_1012473 | Not Available | 781 | Open in IMG/M |
| 3300022498|Ga0242644_1028179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 592 | Open in IMG/M |
| 3300022499|Ga0242641_1009814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 837 | Open in IMG/M |
| 3300022499|Ga0242641_1011733 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 794 | Open in IMG/M |
| 3300022499|Ga0242641_1012750 | Not Available | 775 | Open in IMG/M |
| 3300022500|Ga0242643_104502 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 877 | Open in IMG/M |
| 3300022500|Ga0242643_105665 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
| 3300022500|Ga0242643_105798 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
| 3300022500|Ga0242643_106254 | Not Available | 790 | Open in IMG/M |
| 3300022500|Ga0242643_117264 | Not Available | 568 | Open in IMG/M |
| 3300022501|Ga0242645_1016114 | Not Available | 632 | Open in IMG/M |
| 3300022502|Ga0242646_1007299 | Not Available | 858 | Open in IMG/M |
| 3300022502|Ga0242646_1009011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
| 3300022502|Ga0242646_1035536 | Not Available | 526 | Open in IMG/M |
| 3300022503|Ga0242650_1005420 | Not Available | 843 | Open in IMG/M |
| 3300022503|Ga0242650_1007700 | Not Available | 755 | Open in IMG/M |
| 3300022503|Ga0242650_1007959 | Not Available | 747 | Open in IMG/M |
| 3300022503|Ga0242650_1015172 | Not Available | 604 | Open in IMG/M |
| 3300022503|Ga0242650_1016763 | Not Available | 586 | Open in IMG/M |
| 3300022504|Ga0242642_1029176 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 790 | Open in IMG/M |
| 3300022505|Ga0242647_1010646 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
| 3300022506|Ga0242648_1023750 | Not Available | 805 | Open in IMG/M |
| 3300022506|Ga0242648_1024416 | Not Available | 799 | Open in IMG/M |
| 3300022506|Ga0242648_1025446 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 789 | Open in IMG/M |
| 3300022506|Ga0242648_1062463 | Not Available | 589 | Open in IMG/M |
| 3300022506|Ga0242648_1089495 | Not Available | 524 | Open in IMG/M |
| 3300022507|Ga0222729_1007227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300022507|Ga0222729_1017836 | Not Available | 815 | Open in IMG/M |
| 3300022507|Ga0222729_1019048 | Not Available | 798 | Open in IMG/M |
| 3300022508|Ga0222728_1034412 | Not Available | 798 | Open in IMG/M |
| 3300022508|Ga0222728_1072971 | Not Available | 612 | Open in IMG/M |
| 3300022509|Ga0242649_1019372 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
| 3300022510|Ga0242652_1014061 | Not Available | 797 | Open in IMG/M |
| 3300022510|Ga0242652_1038880 | Not Available | 573 | Open in IMG/M |
| 3300022511|Ga0242651_1013113 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
| 3300022512|Ga0242676_1011095 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 824 | Open in IMG/M |
| 3300022512|Ga0242676_1011527 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
| 3300022512|Ga0242676_1012302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
| 3300022512|Ga0242676_1012491 | Not Available | 798 | Open in IMG/M |
| 3300022512|Ga0242676_1012593 | Not Available | 796 | Open in IMG/M |
| 3300022512|Ga0242676_1045337 | Not Available | 536 | Open in IMG/M |
| 3300022513|Ga0242667_1012255 | Not Available | 801 | Open in IMG/M |
| 3300022513|Ga0242667_1057943 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 507 | Open in IMG/M |
| 3300022522|Ga0242659_1028538 | Not Available | 900 | Open in IMG/M |
| 3300022522|Ga0242659_1031475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 869 | Open in IMG/M |
| 3300022522|Ga0242659_1037175 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
| 3300022522|Ga0242659_1037403 | Not Available | 817 | Open in IMG/M |
| 3300022522|Ga0242659_1040585 | Not Available | 794 | Open in IMG/M |
| 3300022522|Ga0242659_1106950 | Not Available | 559 | Open in IMG/M |
| 3300022523|Ga0242663_1037243 | Not Available | 811 | Open in IMG/M |
| 3300022523|Ga0242663_1038146 | Not Available | 804 | Open in IMG/M |
| 3300022523|Ga0242663_1043082 | Not Available | 772 | Open in IMG/M |
| 3300022525|Ga0242656_1037739 | Not Available | 798 | Open in IMG/M |
| 3300022525|Ga0242656_1104990 | Not Available | 558 | Open in IMG/M |
| 3300022527|Ga0242664_1041175 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
| 3300022527|Ga0242664_1042606 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300022527|Ga0242664_1044595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 792 | Open in IMG/M |
| 3300022527|Ga0242664_1046399 | Not Available | 781 | Open in IMG/M |
| 3300022528|Ga0242669_1032124 | Not Available | 826 | Open in IMG/M |
| 3300022528|Ga0242669_1034103 | Not Available | 809 | Open in IMG/M |
| 3300022528|Ga0242669_1035003 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
| 3300022528|Ga0242669_1037113 | Not Available | 788 | Open in IMG/M |
| 3300022528|Ga0242669_1038299 | Not Available | 779 | Open in IMG/M |
| 3300022528|Ga0242669_1043851 | Not Available | 745 | Open in IMG/M |
| 3300022528|Ga0242669_1052793 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 700 | Open in IMG/M |
| 3300022529|Ga0242668_1037803 | Not Available | 815 | Open in IMG/M |
| 3300022529|Ga0242668_1038350 | Not Available | 811 | Open in IMG/M |
| 3300022529|Ga0242668_1040197 | Not Available | 799 | Open in IMG/M |
| 3300022529|Ga0242668_1051801 | Not Available | 734 | Open in IMG/M |
| 3300022529|Ga0242668_1082032 | Not Available | 628 | Open in IMG/M |
| 3300022529|Ga0242668_1089347 | Not Available | 610 | Open in IMG/M |
| 3300022531|Ga0242660_1071625 | Not Available | 799 | Open in IMG/M |
| 3300022531|Ga0242660_1072047 | Not Available | 798 | Open in IMG/M |
| 3300022532|Ga0242655_10093914 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
| 3300022532|Ga0242655_10096876 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300022532|Ga0242655_10137392 | Not Available | 705 | Open in IMG/M |
| 3300022532|Ga0242655_10231794 | Not Available | 577 | Open in IMG/M |
| 3300022533|Ga0242662_10101423 | Not Available | 821 | Open in IMG/M |
| 3300022708|Ga0242670_1017300 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 828 | Open in IMG/M |
| 3300022708|Ga0242670_1018904 | Not Available | 806 | Open in IMG/M |
| 3300022708|Ga0242670_1019287 | Not Available | 802 | Open in IMG/M |
| 3300022708|Ga0242670_1035716 | Not Available | 660 | Open in IMG/M |
| 3300022709|Ga0222756_1022569 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
| 3300022709|Ga0222756_1023070 | Not Available | 811 | Open in IMG/M |
| 3300022709|Ga0222756_1023347 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300022709|Ga0222756_1024043 | Not Available | 800 | Open in IMG/M |
| 3300022709|Ga0222756_1024118 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
| 3300022709|Ga0222756_1024418 | Not Available | 796 | Open in IMG/M |
| 3300022709|Ga0222756_1090895 | Not Available | 511 | Open in IMG/M |
| 3300022711|Ga0242674_1017510 | Not Available | 811 | Open in IMG/M |
| 3300022711|Ga0242674_1018050 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
| 3300022712|Ga0242653_1013398 | Not Available | 1057 | Open in IMG/M |
| 3300022712|Ga0242653_1029691 | Not Available | 812 | Open in IMG/M |
| 3300022712|Ga0242653_1031932 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 792 | Open in IMG/M |
| 3300022714|Ga0242671_1021457 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 904 | Open in IMG/M |
| 3300022714|Ga0242671_1066529 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 629 | Open in IMG/M |
| 3300022715|Ga0242678_1018715 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 822 | Open in IMG/M |
| 3300022715|Ga0242678_1020786 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 797 | Open in IMG/M |
| 3300022715|Ga0242678_1021361 | Not Available | 791 | Open in IMG/M |
| 3300022716|Ga0242673_1033513 | Not Available | 800 | Open in IMG/M |
| 3300022716|Ga0242673_1033624 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
| 3300022716|Ga0242673_1047435 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 714 | Open in IMG/M |
| 3300022716|Ga0242673_1063918 | Not Available | 647 | Open in IMG/M |
| 3300022717|Ga0242661_1034404 | Not Available | 889 | Open in IMG/M |
| 3300022718|Ga0242675_1029499 | Not Available | 825 | Open in IMG/M |
| 3300022718|Ga0242675_1031671 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
| 3300022718|Ga0242675_1032418 | Not Available | 801 | Open in IMG/M |
| 3300022718|Ga0242675_1032662 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
| 3300022720|Ga0242672_1029350 | Not Available | 822 | Open in IMG/M |
| 3300022720|Ga0242672_1030075 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
| 3300022720|Ga0242672_1031729 | Not Available | 804 | Open in IMG/M |
| 3300022721|Ga0242666_1096670 | Not Available | 679 | Open in IMG/M |
| 3300022722|Ga0242657_1114464 | Not Available | 678 | Open in IMG/M |
| 3300022724|Ga0242665_10113543 | Not Available | 818 | Open in IMG/M |
| 3300022724|Ga0242665_10116230 | Not Available | 811 | Open in IMG/M |
| 3300022726|Ga0242654_10305067 | Not Available | 587 | Open in IMG/M |
| 3300023536|Ga0247552_100950 | Not Available | 809 | Open in IMG/M |
| 3300023537|Ga0247541_102561 | Not Available | 557 | Open in IMG/M |
| 3300023539|Ga0247555_100981 | Not Available | 822 | Open in IMG/M |
| 3300023542|Ga0247540_101105 | Not Available | 797 | Open in IMG/M |
| 3300023542|Ga0247540_102910 | Not Available | 581 | Open in IMG/M |
| 3300023552|Ga0247551_101471 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
| 3300023552|Ga0247551_102601 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 664 | Open in IMG/M |
| 3300023563|Ga0247530_109151 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300023660|Ga0247550_101219 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 790 | Open in IMG/M |
| 3300023660|Ga0247550_101389 | Not Available | 762 | Open in IMG/M |
| 3300023672|Ga0247553_102835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
| 3300023677|Ga0247543_101493 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
| 3300023700|Ga0228707_1042598 | Not Available | 654 | Open in IMG/M |
| 3300028089|Ga0255299_1054378 | Not Available | 748 | Open in IMG/M |
| 3300028089|Ga0255299_1106688 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 526 | Open in IMG/M |
| 3300028619|Ga0257136_1044235 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
| 3300028620|Ga0257139_1040638 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 796 | Open in IMG/M |
| 3300028623|Ga0257141_1049978 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 784 | Open in IMG/M |
| 3300028653|Ga0265323_10169032 | Not Available | 695 | Open in IMG/M |
| 3300028668|Ga0257140_1044894 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
| 3300028742|Ga0302220_10142317 | Not Available | 918 | Open in IMG/M |
| 3300028783|Ga0302279_10096708 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300029636|Ga0222749_10318645 | Not Available | 808 | Open in IMG/M |
| 3300029636|Ga0222749_10321935 | Not Available | 804 | Open in IMG/M |
| 3300029636|Ga0222749_10353500 | Not Available | 770 | Open in IMG/M |
| 3300029638|Ga0257144_1030592 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300029655|Ga0206091_107728 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300029655|Ga0206091_107743 | Not Available | 807 | Open in IMG/M |
| 3300029674|Ga0265604_116475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 759 | Open in IMG/M |
| 3300029680|Ga0265599_1020473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 793 | Open in IMG/M |
| 3300029701|Ga0222748_1051865 | Not Available | 705 | Open in IMG/M |
| 3300030526|Ga0210267_1076291 | Not Available | 676 | Open in IMG/M |
| 3300030535|Ga0210285_1284331 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 757 | Open in IMG/M |
| 3300030536|Ga0210266_1033643 | Not Available | 824 | Open in IMG/M |
| 3300030545|Ga0210271_10661874 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
| 3300030545|Ga0210271_10694528 | Not Available | 519 | Open in IMG/M |
| 3300030577|Ga0210260_10112255 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 782 | Open in IMG/M |
| 3300030578|Ga0210275_10102655 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 779 | Open in IMG/M |
| 3300030589|Ga0210255_10430489 | Not Available | 599 | Open in IMG/M |
| 3300030596|Ga0210278_1053754 | Not Available | 780 | Open in IMG/M |
| 3300030602|Ga0210254_10685692 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 763 | Open in IMG/M |
| 3300030630|Ga0210282_10117151 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 751 | Open in IMG/M |
| 3300030631|Ga0210279_10149902 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 778 | Open in IMG/M |
| 3300030632|Ga0210250_11775498 | Not Available | 776 | Open in IMG/M |
| 3300030712|Ga0307921_1015169 | Not Available | 809 | Open in IMG/M |
| 3300030712|Ga0307921_1015501 | Not Available | 801 | Open in IMG/M |
| 3300030718|Ga0307919_1026427 | Not Available | 793 | Open in IMG/M |
| 3300030730|Ga0307482_1088291 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 829 | Open in IMG/M |
| 3300030730|Ga0307482_1089876 | Not Available | 823 | Open in IMG/M |
| 3300030730|Ga0307482_1094539 | Not Available | 808 | Open in IMG/M |
| 3300030730|Ga0307482_1100387 | Not Available | 791 | Open in IMG/M |
| 3300030730|Ga0307482_1320216 | Not Available | 503 | Open in IMG/M |
| 3300030740|Ga0265460_11045207 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 760 | Open in IMG/M |
| 3300030758|Ga0138305_1560723 | Not Available | 818 | Open in IMG/M |
| 3300030759|Ga0265745_1017844 | Not Available | 597 | Open in IMG/M |
| 3300030760|Ga0265762_1056413 | Not Available | 799 | Open in IMG/M |
| 3300030762|Ga0265775_102358 | Not Available | 972 | Open in IMG/M |
| 3300030762|Ga0265775_104091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
| 3300030762|Ga0265775_104291 | Not Available | 797 | Open in IMG/M |
| 3300030805|Ga0265756_115194 | Not Available | 532 | Open in IMG/M |
| 3300030806|Ga0265731_100646 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 944 | Open in IMG/M |
| 3300030806|Ga0265731_101386 | Not Available | 753 | Open in IMG/M |
| 3300030812|Ga0265734_103824 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 615 | Open in IMG/M |
| 3300030816|Ga0265729_102332 | Not Available | 642 | Open in IMG/M |
| 3300030816|Ga0265729_103738 | Not Available | 560 | Open in IMG/M |
| 3300030824|Ga0265726_101716 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 797 | Open in IMG/M |
| 3300030833|Ga0265736_103222 | Not Available | 605 | Open in IMG/M |
| 3300030834|Ga0265738_102044 | Not Available | 762 | Open in IMG/M |
| 3300030836|Ga0265767_105847 | Not Available | 754 | Open in IMG/M |
| 3300030836|Ga0265767_111677 | Not Available | 599 | Open in IMG/M |
| 3300030849|Ga0075393_10923413 | Not Available | 780 | Open in IMG/M |
| 3300030862|Ga0265753_1055848 | Not Available | 713 | Open in IMG/M |
| 3300030862|Ga0265753_1055852 | Not Available | 713 | Open in IMG/M |
| 3300030863|Ga0265766_1009709 | Not Available | 677 | Open in IMG/M |
| 3300030874|Ga0265742_1016549 | Not Available | 602 | Open in IMG/M |
| 3300030875|Ga0265727_101005 | Not Available | 808 | Open in IMG/M |
| 3300030877|Ga0265777_107107 | Not Available | 775 | Open in IMG/M |
| 3300030879|Ga0265765_1018962 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 820 | Open in IMG/M |
| 3300030880|Ga0265776_103123 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 794 | Open in IMG/M |
| 3300030880|Ga0265776_105110 | Not Available | 684 | Open in IMG/M |
| 3300030884|Ga0265758_103915 | Not Available | 682 | Open in IMG/M |
| 3300030886|Ga0265772_101809 | Not Available | 805 | Open in IMG/M |
| 3300030889|Ga0265761_103026 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
| 3300030913|Ga0265759_102739 | Not Available | 799 | Open in IMG/M |
| 3300030913|Ga0265759_105095 | Not Available | 652 | Open in IMG/M |
| 3300030939|Ga0138303_1357685 | Not Available | 558 | Open in IMG/M |
| 3300030944|Ga0074009_10843321 | Not Available | 501 | Open in IMG/M |
| 3300030975|Ga0099845_1009097 | Not Available | 713 | Open in IMG/M |
| 3300030975|Ga0099845_1011420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 625 | Open in IMG/M |
| 3300030982|Ga0265748_102201 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
| 3300030982|Ga0265748_102364 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 782 | Open in IMG/M |
| 3300031016|Ga0265732_102796 | Not Available | 617 | Open in IMG/M |
| 3300031040|Ga0265754_1010872 | Not Available | 723 | Open in IMG/M |
| 3300031041|Ga0265755_104082 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| 3300031041|Ga0265755_107477 | Not Available | 655 | Open in IMG/M |
| 3300031043|Ga0265779_103117 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 826 | Open in IMG/M |
| 3300031057|Ga0170834_112417141 | Not Available | 507 | Open in IMG/M |
| 3300031122|Ga0170822_10497303 | Not Available | 578 | Open in IMG/M |
| 3300031128|Ga0170823_15677694 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
| 3300031231|Ga0170824_116017080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 717 | Open in IMG/M |
| 3300031242|Ga0265329_10046039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1394 | Open in IMG/M |
| 3300031474|Ga0170818_115155922 | Not Available | 770 | Open in IMG/M |
| 3300031490|Ga0314825_105305 | Not Available | 796 | Open in IMG/M |
| 3300031590|Ga0307483_1010033 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 820 | Open in IMG/M |
| 3300031590|Ga0307483_1010898 | Not Available | 800 | Open in IMG/M |
| 3300031636|Ga0310113_115952 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
| 3300031663|Ga0307484_104846 | Not Available | 807 | Open in IMG/M |
| 3300031663|Ga0307484_104864 | Not Available | 806 | Open in IMG/M |
| 3300031663|Ga0307484_111310 | Not Available | 604 | Open in IMG/M |
| 3300031663|Ga0307484_113799 | Not Available | 570 | Open in IMG/M |
| 3300031664|Ga0310118_109871 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
| 3300031677|Ga0307480_1004932 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 817 | Open in IMG/M |
| 3300031678|Ga0310114_112613 | Not Available | 810 | Open in IMG/M |
| 3300031712|Ga0265342_10649911 | Not Available | 529 | Open in IMG/M |
| 3300031829|Ga0316050_102411 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300031870|Ga0316029_104300 | Not Available | 722 | Open in IMG/M |
| 3300031870|Ga0316029_105566 | Not Available | 656 | Open in IMG/M |
| 3300031871|Ga0316036_105328 | Not Available | 799 | Open in IMG/M |
| 3300031872|Ga0316033_110141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 578 | Open in IMG/M |
| 3300031955|Ga0316035_106835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
| 3300031955|Ga0316035_107157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
| 3300032072|Ga0326631_104503 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
| 3300032119|Ga0316051_1008858 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
| 3300032121|Ga0316040_106824 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 746 | Open in IMG/M |
| 3300032515|Ga0348332_12259273 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1002 | Open in IMG/M |
| 3300032515|Ga0348332_14170001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 753 | Open in IMG/M |
| 3300032756|Ga0315742_11151739 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 790 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.60% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.24% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.02% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 4.90% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.67% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 2.45% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 2.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.34% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.11% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.56% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.45% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.45% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.45% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.22% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.22% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.22% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.22% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.22% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.22% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.22% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.22% |
| Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.22% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002647 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF118 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004600 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 56 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004614 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005646 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007327 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaT_ABR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300008785 | Microbial communities from wetland soil in Czech Republic - R1_cDNA | Environmental | Open in IMG/M |
| 3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
| 3300009221 | Microbial communities of water from Amazon river, Brazil - RCM2 | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
| 3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
| 3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
| 3300009254 | Microbial communities of water from Amazon river, Brazil - RCM20 | Environmental | Open in IMG/M |
| 3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
| 3300009352 | Microbial communities of water from Amazon river, Brazil - RCM18 | Environmental | Open in IMG/M |
| 3300009579 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009580 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009582 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009586 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009755 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010164 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010198 | Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300010305 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011016 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 81 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011019 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 38 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011020 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 78 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011023 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 29 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011025 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 46 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011027 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 70 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011028 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 64 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011029 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 32 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011034 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 30 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011040 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 79 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011043 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011047 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011051 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011053 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011054 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011059 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011062 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011063 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011065 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011066 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011067 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011068 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012411 | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012746 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES049 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012747 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES063 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300016687 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES104 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016701 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019155 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019158 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019159 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019160 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019162 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019163 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019164 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019168 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019170 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019174 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019176 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019177 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019178 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019180 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019184 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019186 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019189 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019199 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019211 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019230 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019250 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019251 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021259 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_2_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021909 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - NH:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022147 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 2-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022500 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022503 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023536 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023537 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023539 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023542 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023563 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023677 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023700 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028089 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028619 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_45m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028620 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_80m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028623 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Host-Associated | Open in IMG/M |
| 3300028668 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_120m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029638 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_80m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029655 | Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_5-13C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029674 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_50m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029680 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_50m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030526 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030535 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030536 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030577 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030589 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030630 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030631 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030632 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030712 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030718 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030758 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030759 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030805 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030806 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030812 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030816 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030824 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030833 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030834 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030849 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030874 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030875 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030884 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030913 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030939 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030944 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030975 | Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030982 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031016 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031041 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031490 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031663 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031664 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031829 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031870 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031871 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031872 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031955 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032072 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032121 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0005469J37257_1009631 | 3300002647 | Forest Soil | MRSKSSHAAKSGVGEHTARESESAQRVRRERVRGEHPPPNL |
| Ga0058882_10286501 | 3300004121 | Forest Soil | MRSTASRAAKSGVGEHTARESESAQCVRWERVRGEHPPPI |
| Ga0068964_10248432 | 3300004600 | Peatlands Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVRGEHPPPNLAP |
| Ga0068956_10153283 | 3300004614 | Peatlands Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVRGEHPPPNLAPG |
| Ga0075040_10826761 | 3300005646 | Permafrost Soil | MRLRTSHAAKSGVGEYTARESECAQRMRWERARGERPPPNLA |
| Ga0075037_10858721 | 3300006426 | Permafrost Soil | MRSKSSPAAKSGVGEHMARESESAQYMPRERVRGEHPPPNL |
| Ga0063777_10025671 | 3300006861 | Peatlands Soil | MRPETTLAALSGVGEQTARESESAQCLRRERVRGEHPP |
| Ga0075016_10863741 | 3300007327 | Watersheds | MRSITSHAAESGVGEHTARESECAQRMRRERVRGEHPPP |
| Ga0103638_10006301 | 3300008785 | Wetland Soil | MRSIPSHAAKSGVGEHTARESESAQRMRRERACGERPPPNLALEPQG |
| Ga0103848_10535522 | 3300009218 | River Water | MRSITSHAAKSGVGEHTARESESAQCMRRERLCGEQP |
| Ga0103849_10265191 | 3300009221 | River Water | MRSITSHAAKSGVGEHTARESESAQCMRRERLCGEQ |
| Ga0103856_100428151 | 3300009233 | River Water | MRSKSLHAAVSGVGKHTARESESAKCVRRERARGERPP |
| Ga0103857_100557171 | 3300009235 | River Water | MRSKSLHAAVSGVGKHTARESESAKCVRRERARGE |
| Ga0103860_100486571 | 3300009243 | River Water | MRSITSHAAESGVGEHTARESESAQCMYRERLRGEQPPPILGPG |
| Ga0103861_100276151 | 3300009247 | River Water | MRSITSHAAKSGVGEHTARESESAQCMRRERLRGEQ |
| Ga0103867_10142451 | 3300009254 | River Water | MRSITSHAAKSGVGEHTARESESAQCMRRERLCAGKDCVA |
| Ga0103869_100749571 | 3300009257 | River Water | MRSITSHAAKSGVGEHTARESESAQCMRRERLRGERPP |
| Ga0103869_102122911 | 3300009257 | River Water | MRSRTSHAAESGVGEHTARESESAQCMYRERLRGEQPP |
| Ga0103865_10045822 | 3300009352 | River Water | MRSITSHAAKSGVGEHTARESESAQCMRRERLCGE |
| Ga0115599_10115631 | 3300009579 | Wetland | MRPKALHAAVSGVGEHTARESESAKCMRRERAVANAHP |
| Ga0115596_10645331 | 3300009580 | Wetland | MRPKALHAAVSSVGEHTARESESAQCMQRERARGERP |
| Ga0115601_10048201 | 3300009582 | Wetland | MRSKSLLSAASGFGEHTARESESAKCMYRERASGERPP |
| Ga0115591_11830771 | 3300009586 | Wetland | MRSKALLSAASGVGEHAARESESAKRMYRERASGERP |
| Ga0115592_11616751 | 3300009755 | Wetland | MRSKALLSAASGVGEHAARESESAKRMYRERASGERPP |
| Ga0126318_100657872 | 3300010152 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPWERVRGEHP |
| Ga0127503_111032451 | 3300010154 | Soil | MRSRTSHAAKSGVGEHTARESECAQRVRRERVCGEH |
| Ga0063827_1375403 | 3300010164 | Peatlands Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVRGEH |
| Ga0127509_10290211 | 3300010198 | Host-Associated | MRSIPSHAAKSGVGEHMARESEAPNIMRRERVRGEHPP |
| Ga0129320_1246631 | 3300010305 | Aqueous | MRSKTSHAAKSGVGEHTARESESAQRMRWERVRGEH |
| Ga0126345_10180531 | 3300010858 | Boreal Forest Soil | MRSKTSHAAKSGVGEHMARESESAQYMPWERARGERPP |
| Ga0126345_11101561 | 3300010858 | Boreal Forest Soil | MRSKTSYAAKSGVGEHTARESESAQRVCWERVRGEHPPPNLAL |
| Ga0126352_10830592 | 3300010859 | Boreal Forest Soil | MRSKTSHAAKSGVGEHMARESESAQYMPRERARGERPP |
| Ga0126348_11069391 | 3300010862 | Boreal Forest Soil | MRSITSHAAVSSVGEHTARESECAQRVRRERVRGE |
| Ga0126348_12326862 | 3300010862 | Boreal Forest Soil | MRSRTSHAAESGVGEHTARESESAQRVCRERVRGEHP |
| Ga0126357_11378531 | 3300010864 | Boreal Forest Soil | MRSRTSHAAKSGVGEHTARESESAQRVCRERVCGEHP |
| Ga0126346_10839771 | 3300010865 | Boreal Forest Soil | MRSTTSHAAVSSVGEHTARESECAQRVRRERVRGEHPPP |
| Ga0126344_12231731 | 3300010866 | Boreal Forest Soil | MRSITSHAAKSGVGEHTARESESAKRVCRERARGE |
| Ga0126344_12330642 | 3300010866 | Boreal Forest Soil | MRSKSSHAAESGVGEHTARESECAQRVRRERARGERPPPNLAL |
| Ga0126361_103048022 | 3300010876 | Boreal Forest Soil | MRSTTSHAAVSSVGEHTARESECAQRVRRERVRDE |
| Ga0126361_111022691 | 3300010876 | Boreal Forest Soil | MRSRTSHAAKSGVGEYTARESECAQRMRRERACGERPP |
| Ga0138589_1095471 | 3300011016 | Peatlands Soil | MRSKSSHAAESGVGEHTARESECAQCVRRERVRGEHP |
| Ga0138557_1025201 | 3300011019 | Peatlands Soil | MRSITSHAAESGVGEHTARESESAQRMRWERVRGEHP |
| Ga0138557_1162591 | 3300011019 | Peatlands Soil | MRSKSSHAAKSGVGEHTARESECAQRMRWERARGER |
| Ga0138602_1080641 | 3300011020 | Peatlands Soil | MRSITSHAAESGVGEHTARESESAQCMRRERVCGEHP |
| Ga0138548_1081281 | 3300011023 | Peatlands Soil | MRSKTSHAAESGVWEHTARESESAQRVCRERARGERPP |
| Ga0138548_1107101 | 3300011023 | Peatlands Soil | MRSKSSHAAKSGVGEHTARESECAQRMRWERARGERP |
| Ga0138548_1109581 | 3300011023 | Peatlands Soil | MRSITSHAAESGVGEHTARESECAQRVRRERARGER |
| Ga0138548_1182332 | 3300011023 | Peatlands Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVRGEHP |
| Ga0138561_1222591 | 3300011025 | Peatlands Soil | MRSRSSHAAESGVGEHTARESECAQRMRRERARGERPP |
| Ga0138580_1044662 | 3300011027 | Peatlands Soil | MRSKTSHAAESGVGEHTARESESAQCVCRERARGER |
| Ga0138577_1028641 | 3300011028 | Peatlands Soil | MRSRSSHAAESGVGEHTARESECAQRMRWERARGELPPPNLAPG |
| Ga0138577_1229191 | 3300011028 | Peatlands Soil | MRSITSHAAESGVGEHTARESESAQCMRRERVCGEH |
| Ga0138551_1146341 | 3300011029 | Peatlands Soil | MRSKTSHAAESGVGEHTARESESAQRVCRERARGER |
| Ga0138549_1012922 | 3300011034 | Peatlands Soil | MRSKTSHAAESGVGEHTARESESAQRVCRERARGERP |
| Ga0138549_1164731 | 3300011034 | Peatlands Soil | MRSTTSHAAKSGVGEHTARESECAQRVRRERARGER |
| Ga0138549_1172671 | 3300011034 | Peatlands Soil | MRSRSSHAAESGVGEHTARESECAQRMRRERACGER |
| Ga0138587_1459102 | 3300011040 | Peatlands Soil | MRSISSHAAESGVGEHTARESESAQCVRRERVRGEH |
| Ga0138528_1596071 | 3300011043 | Peatlands Soil | MRSRSSHAAESGVGEHTARESECAQRMRRERARGE |
| Ga0138553_1499281 | 3300011047 | Peatlands Soil | MRSITSHAAESGVGEHTARESESAQCMRRERVCGEHPPPNLAP |
| Ga0138540_1224011 | 3300011051 | Peatlands Soil | MRSRSSHAAESGVGEHTARESECAQRVRRERARGERPP |
| Ga0138531_1340611 | 3300011053 | Peatlands Soil | MRSITSHAAESGVGEHTARESECAQRVRRERARGERP |
| Ga0138523_11013191 | 3300011054 | Peatlands Soil | MRSKTSHAAESGVGEHTARESESAQRVCRERARGERPPPIWP |
| Ga0138597_10051272 | 3300011059 | Peatlands Soil | MRLRTSHAAKSGVGEHAARESESAQRMRWERARGERPP |
| Ga0138582_10114321 | 3300011062 | Peatlands Soil | MRSKTSHAAESGVGEHTARESESAQRVCRERARGE |
| Ga0138582_10235921 | 3300011062 | Peatlands Soil | MRSISSHAAESGVGEHTARESESAQCVRRERVRGEHPPPNLAP |
| Ga0138537_10183532 | 3300011063 | Peatlands Soil | MRSKTSHAAESGVGEHTARESESAQRVCRERARGERPPP |
| Ga0138537_10391201 | 3300011063 | Peatlands Soil | MRSRSSHAAESGVGEHTARESECAQRMRWERARGERPPPNLASE |
| Ga0138525_10938212 | 3300011064 | Peatlands Soil | MRSKPALAALSGVGEHTARESESAQCVHRERVRGEHP |
| Ga0138525_11047832 | 3300011064 | Peatlands Soil | MRSRSSHAAESGVGEHTARESECAQRMRRERARGERPPP |
| Ga0138533_10672441 | 3300011065 | Peatlands Soil | MRSRTSPAAKSGVGEYTARESECAQRVRRERARGER |
| Ga0138524_11369811 | 3300011066 | Peatlands Soil | MRSRSSHAAESGVGEHTARESECAQRMRRERACGERPP |
| Ga0138594_10808081 | 3300011067 | Peatlands Soil | MRSITSHAAESGVGEHTARESESAQCMRRERVCGEHPP |
| Ga0138599_11094231 | 3300011068 | Peatlands Soil | MRSISSHAAESGVGEYTARESESAQCVRRERVRGEH |
| Ga0138584_10503471 | 3300011073 | Peatlands Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVRGE |
| Ga0138559_10935402 | 3300011074 | Peatlands Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVRGEHPPPNLA |
| Ga0138555_10310252 | 3300011075 | Peatlands Soil | MRSRTSHAAESSVGEHTARESESAQCVRRERVRGEHPP |
| Ga0138562_11784871 | 3300011084 | Peatlands Soil | MRSITSHAAESGVGEHTARESESAQCMRRERVCGEHPPP |
| Ga0138581_10374302 | 3300011085 | Peatlands Soil | MRSISSHAAESGVGEHTARESESAQCVRRERVRGEHPP |
| Ga0138570_11016881 | 3300011087 | Peatlands Soil | MRSRPSHAAKSGVGEHTARESESAQRMRRERACGER |
| Ga0138576_10328291 | 3300011088 | Peatlands Soil | MRSRSSHAAESGVGEHTARESECAQRVRRERARGERP |
| Ga0138576_12349691 | 3300011088 | Peatlands Soil | MRSISSHAAESGVGEHTARESESAQCVRRERVRGEHPPPNLA |
| Ga0138578_10402471 | 3300011110 | Peatlands Soil | MRSITSHAAESGVGEHTARESESAQCMRWERASGDR |
| Ga0150983_114668872 | 3300011120 | Forest Soil | MRSKTSHAAKSGVGEHTARESEAPNAVRRERVRGEH |
| Ga0150983_162904682 | 3300011120 | Forest Soil | MRSKPALAALSGVGEQTARESESAKRLRRERVRGEH |
| Ga0126317_100179541 | 3300011332 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVVRRERVCGEH |
| Ga0151652_119042481 | 3300011340 | Wetland | MRPKALHAAVSSVGEHTARESESAQCMRRERASGE |
| Ga0150985_1170231301 | 3300012212 | Avena Fatua Rhizosphere | MRSTTSHAAKSGVGELTARESECAQRRRRERARGERPPPIWPR |
| Ga0134033_11885401 | 3300012383 | Grasslands Soil | MRPRHPHAAESGVGEHTARESEAPNVCRRERARGERPP |
| Ga0134043_10764951 | 3300012392 | Grasslands Soil | MRPKHPHAAESGVGEHTARESERPNVCRRERARGERP |
| Ga0153880_11068061 | 3300012411 | Freshwater Sediment | MRSRSSHAARSGVGEHTARESESAKRVCRERASGDRPP |
| Ga0153880_12500033 | 3300012411 | Freshwater Sediment | MRSITSHAAESSVGEHTARESESAQCMRRERVRGAHPPPILG |
| Ga0153880_12532001 | 3300012411 | Freshwater Sediment | MRSIPSPAAKSGVGEHTARESESAQRVRRGRARGERPPPSLAL |
| Ga0157556_1267401 | 3300012746 | Freshwater | MRSITSHAAESGVGEHTARESESAQCMYRERLRGEQPH |
| Ga0157564_10518841 | 3300012747 | Freshwater | MRSRTSHAAKSGVGEHTARESECAQRMSWERARGERPP |
| Ga0182012_107011352 | 3300014499 | Bog | MRSKSSHAAKSGVGEHTARESECAQRVRRERVRGEH |
| Ga0180047_11115201 | 3300016687 | Freshwater | MRSTSSHAAESGVGEHTARESECAQCVRRERVCGEYP |
| Ga0181503_10079771 | 3300016698 | Peatland | MRSITSHAAESGVGEHTARESESAQCVRRERVRGEHP |
| Ga0181513_12063192 | 3300016700 | Peatland | MRSRTSLAAGSGVGEHMARESEAPNNVRWERARGERPP |
| Ga0181509_13574691 | 3300016701 | Peatland | MRSRTSHAAKSGVGEHTARESESAQCVRRGRACGERP |
| Ga0181511_10314441 | 3300016702 | Peatland | MRSRTSHAAKSGVGEHTARESESAKCVRRGRVCGERP |
| Ga0181511_10430652 | 3300016702 | Peatland | MRSRTSHAAESGVGEHTARESECAQRVCRERARGER |
| Ga0181511_11094031 | 3300016702 | Peatland | MRSITSHAARSSVGEHTARESECAQRVRRERACGER |
| Ga0181511_11668302 | 3300016702 | Peatland | MRSKTSHAAKSGVGEHTARESECAQRVRRERACGERP |
| Ga0181507_10624551 | 3300016705 | Peatland | MRSRASHAAKSGVGEHTARESESAQRVCRERARGE |
| Ga0181507_12510212 | 3300016705 | Peatland | MRSKTSHAAKSGVGEHTARESECAQRVRRERACGERPPP |
| Ga0181500_10456801 | 3300016728 | Peatland | MRSIPSHAAKSGVGEHTARESESAQRMRRERACGERP |
| Ga0181500_12543271 | 3300016728 | Peatland | MRSRTSLAAGSGVGEHMARESEAPNNVRWERARGERP |
| Ga0181500_14104941 | 3300016728 | Peatland | MRSRTSPAARSGVGEHTARESESAKRMCRERARGERP |
| Ga0181515_10719221 | 3300016730 | Peatland | MRSTSSHAAESGVGEHTARESECAQCVRRERVCGEYPP |
| Ga0181515_12465841 | 3300016730 | Peatland | MRSITSHAAESGVGEHTARESESAQCVRRERVRGEHPPPNLAPGP |
| Ga0181505_100248251 | 3300016750 | Peatland | MRSRTSHAAESGVGEHTARESECAQCVRRERVRGEHP |
| Ga0181505_100846351 | 3300016750 | Peatland | MRSKTSHAAESGVGEHTARESESAQCVRRGRACGERPP |
| Ga0181505_107263701 | 3300016750 | Peatland | MRSIPSHAAESGVGEHTARESESAQCVRRERVRGEHPPPNLAP |
| Ga0184568_1129991 | 3300019155 | Soil | MRSITSLAAESGVGEHTARESECAQRVRRERVRGE |
| Ga0184580_1033652 | 3300019158 | Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVCGEYP |
| Ga0184580_1118991 | 3300019158 | Soil | MRSTTSPAAKSGVGEHTARESECAQRVRRERACGER |
| Ga0184574_1177121 | 3300019159 | Soil | MRSRTSHAAKSGVGVHTARESECAQRMCRERASGER |
| Ga0184574_1231521 | 3300019159 | Soil | MRSTTSPAAKSGVGEHTARESECAQRVRRERACGERPPP |
| Ga0184577_1165371 | 3300019160 | Soil | MRSRSSHAAKSGVGEHTARESECAQRVCRERARGER |
| Ga0184597_1292702 | 3300019162 | Soil | MRSKTSHAARSGVGEHTARESESAQCMRRERVRGEH |
| Ga0184581_1198672 | 3300019163 | Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVCGEYPP |
| Ga0184582_1002351 | 3300019164 | Soil | MRSKTSHAAKSGVGEHTARESESAQRVRRERVRGEHPP |
| Ga0184582_1117241 | 3300019164 | Soil | MRSRTSHAAKSGVGEHTARESECAQRMRRERACGERP |
| Ga0184582_1213331 | 3300019164 | Soil | MRSTTSPAAKSGVGEHTARESECAQRVRRERACGERPP |
| Ga0184569_1051811 | 3300019168 | Soil | MRSKSSHAAKSGVGEHAARESESAQCMSRERARGER |
| Ga0184569_1114481 | 3300019168 | Soil | MRSRTSHAAKSGVGEHTARESECAQRMCRERVRGEHP |
| Ga0184570_1062161 | 3300019170 | Soil | MRSRSSHAAKSGVGEHTARESECAQRVCRERARGERP |
| Ga0184579_1096831 | 3300019174 | Soil | MRLRTSHAAKSGVGEYTARESECAQRMRWERARGERP |
| Ga0184596_1102581 | 3300019176 | Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVCGEYPPPN |
| Ga0184596_1181952 | 3300019176 | Soil | MRSRTSHAAKSGVGEYTAPERKSAQRMRRERARGER |
| Ga0184592_1182502 | 3300019177 | Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVCGEYPPP |
| Ga0184583_1105341 | 3300019178 | Soil | MRSKSSHAAESGVGEHTARESECAQCVRRERVCGEYP |
| Ga0184578_1081571 | 3300019180 | Soil | MRSTTSPAAKSGVGEHTARESECAQRVRRERACGERP |
| Ga0184590_1069571 | 3300019184 | Soil | MRSITSLAAESGVGEHTARESECAQRMRWERARGERPPSRHEIE |
| Ga0184588_1179351 | 3300019186 | Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVCGE |
| Ga0184588_1368771 | 3300019186 | Soil | MRSITSLAAESGVGEHTARESECAQRVRRERVRGERP |
| Ga0184585_1238492 | 3300019189 | Soil | MRSKTSHAARSGVGEHTARESESAQCMRRERVRGEHP |
| Ga0184585_1411441 | 3300019189 | Soil | MRSITSLAAESGVGEHTARESECAQRVRRERVRGERPPPTL |
| Ga0184603_1478651 | 3300019192 | Soil | MRLRTSHAAKSGVGEHTARESECAQRMRWERARGERPPPNL |
| Ga0187789_13338452 | 3300019199 | Peatland | MRSRSLLAAVSGVGEHTARESECAQRVYRERARGERQ |
| Ga0187799_11412801 | 3300019211 | Peatland | MRSRTSHAAESGVGEHTARESECAQRMRRERARGE |
| Ga0181501_10189871 | 3300019230 | Peatland | MRSKTSHAAESGVGEHTARESESAQRVCRERARGERPP |
| Ga0181501_13845851 | 3300019230 | Peatland | MRSKTSHAAESGVGEHTARESESAQCVRRGRACGER |
| Ga0181510_12767571 | 3300019240 | Peatland | MRSISSHAAESGVGEHTARESECAQCVRRERVRGEHPP |
| Ga0187793_11673391 | 3300019241 | Peatland | MRSKSSHAAKSGVGEHAARESESAQCVRRGRACGERPP |
| Ga0187793_11749801 | 3300019241 | Peatland | MRSRTSHVAKSGVGEHAARESESAQRMRRERARGERP |
| Ga0187793_13483281 | 3300019241 | Peatland | MRSTSSPAAESGVGEHTARESECAQRVRRERACGE |
| Ga0181502_11085591 | 3300019242 | Peatland | MRSIPSHAAESGVGEHTARESESAQCVRRERVRGEHPPPNLA |
| Ga0181502_13497911 | 3300019242 | Peatland | MRSKTSHAAESGVGEHTARESEAPKVCDRERARGERR |
| Ga0187791_11916882 | 3300019245 | Peatland | MRSRTSHAAKSGVGEHTARESESAQCVCWERARGER |
| Ga0187791_13936091 | 3300019245 | Peatland | MRSRSSHAAESGVGEHTARESECAQRMRRERARGERP |
| Ga0187790_11370121 | 3300019250 | Peatland | MRSRSSHAAESGVGEHTARESECAQRMRRERARGER |
| Ga0187795_10591391 | 3300019251 | Peatland | MRSIPSHAAESGVGEHTARESECAQCVRRERARGERP |
| Ga0187795_11773341 | 3300019251 | Peatland | MRSTTSHAAKSGVGEHTARESESAQCVCWERARGERPP |
| Ga0187795_12440612 | 3300019251 | Peatland | MRSKTSHAAESGVGEHTARESESAKCVRRGRARGER |
| Ga0181508_12160491 | 3300019256 | Peatland | MRSKTSHAAKSGVGEHTARESESAKRVRRERVRGEHPPPNLAP |
| Ga0181508_12408371 | 3300019256 | Peatland | MRSKSSHAAKSGVGEHTARESESAQRVRRERVRGEH |
| Ga0181508_12497922 | 3300019256 | Peatland | MRSKTSHAAKSGVGEHTARESESAQCVPRERARGERPPPCKLNA |
| Ga0181508_13179021 | 3300019256 | Peatland | MRSRASHAAKSGVGEHTARESESAQRVCRERARGERP |
| Ga0181508_14483851 | 3300019256 | Peatland | MRSIPSHAAESGVGEHTARESESAQCVRRERVRGEHPP |
| Ga0180115_11157731 | 3300019257 | Groundwater Sediment | MRPRALHAAVSSVGEHMARDKRERQTLCERERARGERPPPNLAR |
| Ga0181504_12013071 | 3300019258 | Peatland | MRSRTSHAAKSGVGEHTARESESAQRVCRERARGE |
| Ga0181504_15298512 | 3300019258 | Peatland | MRSRTSHAAKSGVGEHTARESESAQRMPWERACGERP |
| Ga0181506_11414583 | 3300019260 | Peatland | MRSIPSHAAKSGVGEHMARESEAPNIMRRERVRGEHP |
| Ga0181506_12727392 | 3300019260 | Peatland | MRSIPSHAAESGVGEHTARESECAQCVRRERVRGEHP |
| Ga0187792_14763051 | 3300019265 | Peatland | MRPIPSHAAESGVGELTARESESAQRQRWERECGEL |
| Ga0181514_12337071 | 3300019268 | Peatland | MRSRTSHAAKSGVGEHTARESECAQRMCRERARGER |
| Ga0181514_13620781 | 3300019268 | Peatland | MRSRASHAAKSGVGEHTARESESAQRVCRERARGERPPPAMRS |
| Ga0181512_10246452 | 3300019270 | Peatland | MRSRTSHAAKSGVGEHTARESESAQRVCRERARGERP |
| Ga0181512_17110771 | 3300019270 | Peatland | MRLRTSHAAKSGVGEYTARESECAQRMRRERARGERPPP |
| Ga0181512_17332691 | 3300019270 | Peatland | MRSRASHAAKSGVGEHTARESESAQRVCRERARGERPP |
| Ga0187794_11085672 | 3300019273 | Peatland | MRSRSLLAAVSGVGEHTARESECAQRVYRERARGERQP |
| Ga0187794_11975321 | 3300019273 | Peatland | MRSKTSHAAESGVGEHTARESESAKCVRPGRERGELPPP |
| Ga0187794_13516291 | 3300019273 | Peatland | MRPRPSHAAESGVGERTARESESAKRACMGRERGELRP |
| Ga0187798_14535892 | 3300019275 | Peatland | MRSKSSHAAKSGVGERTARESEAPNVRKRGRARGERP |
| Ga0187798_15366072 | 3300019275 | Peatland | MRSTTSHAAESGVGEHTARESESAQCVRRERARGERPP |
| Ga0187800_12172361 | 3300019278 | Peatland | MRSIPSHAAESGVGEHTARESECAQCVRRERVRGEHPP |
| Ga0187800_13977051 | 3300019278 | Peatland | MRSRASHAAKSGVGEHAARESEGAQRMRWERARGER |
| Ga0187800_14206011 | 3300019278 | Peatland | MRSISSHAAESGVGEHTARESESAQCVRRERVRGEHP |
| Ga0187800_14438611 | 3300019278 | Peatland | MRSRTSHAAKSGVGEHTARESESAQCVRRERVRGEHPP |
| Ga0187800_16116581 | 3300019278 | Peatland | MRSTTSHAAESGVGEHTARESESAQCVRRERACGER |
| Ga0206349_16343181 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSTTSHAAKSGVGELTARESECAQRRRRERASGERP |
| Ga0206355_16024071 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSRSSHAVKSGVGEHAARESESAQRMPWERACGERP |
| Ga0206351_104088392 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSRTSHAAKSGVGELTARESECAQRRRRERARGER |
| Ga0154015_16808312 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSTTSHAAKSGVGELTARESECAQRRRRERARGERP |
| Ga0179584_13876091 | 3300021151 | Vadose Zone Soil | MRSKTSHAAKSGVGEHAARESESAQCMSRERARGERPP |
| Ga0179581_1197311 | 3300021259 | Vadose Zone Soil | MRSITSHAAVSSVGEHTARESECAQRVRRERVRGEHPP |
| Ga0179585_11314781 | 3300021307 | Vadose Zone Soil | MRSITSHAAVSSVGEHTARESECAQRVRRERVRGEHP |
| Ga0213854_10240581 | 3300021855 | Watersheds | MRSITSHAAESGVGEHTARESECAQRMRRERVRGEHP |
| Ga0213854_11425791 | 3300021855 | Watersheds | MRPIPSHAAESGVGELTARESESAKRQRWERERGELR |
| Ga0213854_12922361 | 3300021855 | Watersheds | MRSRSSHAAESGVGEHTARESESAQRMRRERACGERPP |
| Ga0213852_10920501 | 3300021858 | Watersheds | MRSITSHAAESGVGEHTARESECAQRMRRERVRGEH |
| Ga0213851_15426851 | 3300021860 | Watersheds | MRSRSSHAAESGVGEHTARESESAQRMRRERACGERP |
| Ga0213851_15797701 | 3300021860 | Watersheds | MRSKSSHAAESGVGEHTARESECAQRMGRERARGERP |
| Ga0213851_18276091 | 3300021860 | Watersheds | MRSKTSPAAKSGVGEHTARESECAQRVRRERACGERPP |
| Ga0213853_104332721 | 3300021861 | Watersheds | MRPETTHAALSGVGEQTARESESAKRLRRERVRGEHPPP |
| Ga0213853_115890691 | 3300021861 | Watersheds | MRLKTSHAAKSGVGEHTARESECAQRVRRERVRGEH |
| Ga0213846_10131731 | 3300021909 | Watersheds | MRSKSSHAAESGVGEHTARESEAPNSVRRERARGERP |
| Ga0213930_1188571 | 3300022147 | Freshwater | MRSRTSHAAKSGVGEHTARESECAQRVRRERACGERP |
| Ga0213934_10240101 | 3300022156 | Freshwater | MRSKTLHAAVSGVGEHTARESESAQCVHRERARGERPP |
| Ga0224712_103427311 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSRSSHAVRSGVGEHAARESESAQRMPWERACGERP |
| Ga0242644_10054731 | 3300022498 | Soil | MRSRSSHAAKSGVGEHTARESECAQRVCRERARGE |
| Ga0242644_10100052 | 3300022498 | Soil | MRSRTSHAAKSGVGEHAARESESAQRMPWERACGER |
| Ga0242644_10109811 | 3300022498 | Soil | MRSTTSHAAESGVGEHKARESEAPNNVRRERVRGEH |
| Ga0242644_10115331 | 3300022498 | Soil | MRSKTSHAAKSGVGEHAARESESAQCMSRERARGER |
| Ga0242644_10124731 | 3300022498 | Soil | MTSRPSHAAKSGVGEHTARESESAQRMRRKRACGER |
| Ga0242644_10281792 | 3300022498 | Soil | MRSRTSPAAKSGVGEHTARESECAQRMCRERASGERPP |
| Ga0242641_10098141 | 3300022499 | Soil | MRSRTSPAAKSGVGEHTARESECAQRMCRERASGERPPPNFGP |
| Ga0242641_10117331 | 3300022499 | Soil | MRAITSHAAVSSVGEHTARESECAQRVRRERACGERPPP |
| Ga0242641_10127502 | 3300022499 | Soil | MRSTTSHAAVSSVGEHTARESECAQRVRRERVRGEHP |
| Ga0242643_1045021 | 3300022500 | Soil | MRSTTSLAAESGVGEHTARESECAQCVRRERACGER |
| Ga0242643_1056651 | 3300022500 | Soil | MRSRTSHAAKSGVGEHTARESESAQRVCRERARGERPTCVP |
| Ga0242643_1057982 | 3300022500 | Soil | MRSITSHAAESGVGEHTARESECAQRVRRERACGERP |
| Ga0242643_1062541 | 3300022500 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPWERACGE |
| Ga0242643_1172641 | 3300022500 | Soil | MRSRTSHAAKSGVGEHAARESESAQRIPWERACGER |
| Ga0242645_10073882 | 3300022501 | Soil | MRSRTSLAAKSGVGEHTARESEAPNVVRRERVCGE |
| Ga0242645_10161141 | 3300022501 | Soil | MRLRTSHAAKSGVGEYTARESECAQRMRRERARGER |
| Ga0242646_10072991 | 3300022502 | Soil | MRSRTSHAAKSGVGEYTARESECAQRMRRERARGER |
| Ga0242646_10090111 | 3300022502 | Soil | MRSRPSHAAKSGVGEHTARESESAQRVRRERACGER |
| Ga0242646_10355361 | 3300022502 | Soil | MRSITSLAAESGVGEHTARESECAQRVRRERACGERP |
| Ga0242650_10054201 | 3300022503 | Soil | MRSRTSHAAESSVGEHTARESEAPNSVRRERVRGEHPPPILAP |
| Ga0242650_10077001 | 3300022503 | Soil | MRSTASHAAKSGVGEHTARESESAQCVRWERVRGEHPPP |
| Ga0242650_10079591 | 3300022503 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPRERACGE |
| Ga0242650_10151721 | 3300022503 | Soil | MRSITSLAAESGVGEHTARESECAQRVRRERACGE |
| Ga0242650_10167631 | 3300022503 | Soil | MRSKTSHAAKSGVGEHTARESESAQRVRRERVRGEHPPP |
| Ga0242642_10291761 | 3300022504 | Soil | MRSITSHAAVSSVGEHTARESECAQRVRRERACGE |
| Ga0242647_10106461 | 3300022505 | Soil | MRSKTSPAAKSGVGEHTARESECAQRVRRERACGERP |
| Ga0242648_10237502 | 3300022506 | Soil | MRSKSSHAAKSGVGEHTARESECAQRMYWERVRGEHP |
| Ga0242648_10244161 | 3300022506 | Soil | MRSRASHAAKSGVGEHTARESESAQRVCRERARGER |
| Ga0242648_10254462 | 3300022506 | Soil | MRLKTSHAAKSGVGEHTARESECAQRVRRERVRGEHPP |
| Ga0242648_10624631 | 3300022506 | Soil | MRSITSHAAESGVGEHTARESECAQRVRRERACGERPPP |
| Ga0242648_10894951 | 3300022506 | Soil | MRSRTSHAAESGVGEHTARESESAQRVRRERARGER |
| Ga0222729_10072271 | 3300022507 | Soil | MRSKTSHAAESSVGEHTARESEAPNGVRRERARGE |
| Ga0222729_10178361 | 3300022507 | Soil | MRSKSSHAAKSGVGEHAARESESAQRMRRERACGERPPPNL |
| Ga0222729_10190481 | 3300022507 | Soil | MRSRSSHAARSGVGEHTARESESAQRVSRERVRGEH |
| Ga0222728_10344121 | 3300022508 | Soil | MRSITSLAAESGVGEHTARESECAQRVRRERACGERPP |
| Ga0222728_10729711 | 3300022508 | Soil | MRSTTSHAAVSSVGEHTARESECAQRVRRERACGERP |
| Ga0242649_10193721 | 3300022509 | Soil | MRSTTSLAAESGVGEHTARESECAQCVRRERACGE |
| Ga0242652_10140611 | 3300022510 | Soil | MRSTTSHAAKSGVGEHTARESESAQCVRRERACGER |
| Ga0242652_10388801 | 3300022510 | Soil | MRSRTSHAAKSGVGEHTARESECAQRVRRERACGERPPPNLAPGP |
| Ga0242651_10131131 | 3300022511 | Soil | MRSRTSPAAKSGVGEHTARESECAQRMRRERARGERPP |
| Ga0242676_10110951 | 3300022512 | Soil | MRSTTSHAAVSSVGEHTARESECAQRVRRERVRGEHPP |
| Ga0242676_10115271 | 3300022512 | Soil | MRSRPSHAAKSGVGEHTARESESAQRVRRERACGERP |
| Ga0242676_10123022 | 3300022512 | Soil | MRSRTSHAAKSGVGEHTARESECAQRMCRERASGERP |
| Ga0242676_10124912 | 3300022512 | Soil | MRSRTSHAAKSGVGEHAARESESAQCMSRERARGERP |
| Ga0242676_10125932 | 3300022512 | Soil | MRSKTSHAAKSGVGEHTARESESAQRVRRERVRGEH |
| Ga0242676_10453371 | 3300022512 | Soil | MRSKTSHAAESSVGEHTARESEAPNCVRRERARGE |
| Ga0242667_10122551 | 3300022513 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPWERACGERP |
| Ga0242667_10579431 | 3300022513 | Soil | MRSRTSHAAKSGVGEHTARESESAQRVCRERARGER |
| Ga0242659_10285381 | 3300022522 | Soil | MRSRTSHAAESGVGEHTARESEGAQRVRRERARGERPRPNLAP |
| Ga0242659_10314752 | 3300022522 | Soil | MRSRTSHAAESGVGEHTARESESAQCVRWERARGEPP |
| Ga0242659_10371751 | 3300022522 | Soil | MRPETTLAALSGVGEQTARESESAKRLRRERVRGEHPPPNLA |
| Ga0242659_10374033 | 3300022522 | Soil | MRSRTSHAAKSGVGEHAARESESAQRMPWERACGERPPAIW |
| Ga0242659_10405853 | 3300022522 | Soil | MRSKSSHAAKSGVGEHAARESESAQCMSSERVRGE |
| Ga0242659_11069501 | 3300022522 | Soil | MRSITSQAAESGVGEHTARESECAQRVRRERACGERP |
| Ga0242663_10372432 | 3300022523 | Soil | MRSKTSHAAESSVGEHTARESEAPNSVRRERARGERP |
| Ga0242663_10381462 | 3300022523 | Soil | MRSRTSLAAKSGVGEHTARESECAQRMRRERVRGER |
| Ga0242663_10430822 | 3300022523 | Soil | MRLRTSHAAKSGVEEHTARESECAQRVRRERARGE |
| Ga0242656_10377391 | 3300022525 | Soil | MRSRTSHAAKSGVGEHTARESESAQCVPRERARGERPP |
| Ga0242656_11049901 | 3300022525 | Soil | MRSITSHAAVSSVGEHTARESECAQRVRRERVCGEHP |
| Ga0242664_10411751 | 3300022527 | Soil | MRSRTSPAAKSGVGEHTARESECAQRMCRERARGERPPKGS |
| Ga0242664_10426061 | 3300022527 | Soil | MRSIPSHAAKSGVGEHTARESESAQRVCRERVCGEHPP |
| Ga0242664_10445952 | 3300022527 | Soil | MRSKTSHAAKSGVGEHAARESESAQCMSRERARGERP |
| Ga0242664_10463991 | 3300022527 | Soil | MRSITSLAAESGVGEHTARESECAQRVRRERACGERPPPTLT |
| Ga0242669_10321242 | 3300022528 | Soil | MRSRTSHAAKSGVGEHAARESESAQRMPWERACGERPPPIW |
| Ga0242669_10341032 | 3300022528 | Soil | MRSTTSHAAKSGVGEHTARESESAQCVRRERACGERP |
| Ga0242669_10350032 | 3300022528 | Soil | MRLKTSHAAKSGVGEHTARESECAQRVRRERVRGEHP |
| Ga0242669_10371131 | 3300022528 | Soil | MRSIASPAAKSGVGEHTARESESAKRVCRERARGERP |
| Ga0242669_10382992 | 3300022528 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPWERARGERP |
| Ga0242669_10438512 | 3300022528 | Soil | MRSTTSHAAESGVGEHKARESEAPNNVRRERVRGEHPP |
| Ga0242669_10527931 | 3300022528 | Soil | MRLRTSHAAKRGVGEHTARESECAQRVRRERARGE |
| Ga0242668_10378031 | 3300022529 | Soil | MRSRTSHAAESGVGEHTARESECAQRMRRERVRGER |
| Ga0242668_10383502 | 3300022529 | Soil | MRSKTSHAAESSVGEHTARESEAPNSVRRERARGERPP |
| Ga0242668_10401971 | 3300022529 | Soil | MRSKTSHAAESGVGEHTAREIESAQRVCRERARGERPR |
| Ga0242668_10518011 | 3300022529 | Soil | MRSITSHAAESGVGEHTARESECAQRVRRERACGE |
| Ga0242668_10820322 | 3300022529 | Soil | MRLRTSHAAESGVGQHTAPESEGAQRVRRERARGERPP |
| Ga0242668_10893471 | 3300022529 | Soil | MRSRTSHAAKSGVGEHAARESESAQRMPWERACGERP |
| Ga0242660_10716251 | 3300022531 | Soil | MRSKTSHAAESGVGENTARESESAQRVCRERVRGEHPP |
| Ga0242660_10720472 | 3300022531 | Soil | MRSKTSHAAESSVGEHTARESEAPNSVRRERARGER |
| Ga0242655_100939141 | 3300022532 | Soil | MRSTTSPAAKSGVGEHTARESECAQRVRRERVRGEHP |
| Ga0242655_100968761 | 3300022532 | Soil | MRPETTHAALSGVGEQTARESESAKRLRRERVRGEHP |
| Ga0242655_101373921 | 3300022532 | Soil | MRSNTSHAAESGVGEHTARESECAQRVRRERACGER |
| Ga0242655_102317941 | 3300022532 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPRERACGER |
| Ga0242662_101014232 | 3300022533 | Soil | MRSRTSHAAKSGVGEHAARESESAQCMPWERACGERP |
| Ga0242670_10173001 | 3300022708 | Soil | MRSRTSPAAKSGVGEHTARESECAQRMCRERASGERPPPNLALE |
| Ga0242670_10189042 | 3300022708 | Soil | MRSKSSHAAKSGVGEHTARESECAQRMYWERVRGEH |
| Ga0242670_10192871 | 3300022708 | Soil | MRSRTSHAAKSGVGEHTARESECAQRVCRERARGERP |
| Ga0242670_10357161 | 3300022708 | Soil | MRSKTSHAAKSGVGEHRARESESAQPVRRERVRGEHPP |
| Ga0222756_10225691 | 3300022709 | Soil | MRSRTSLAAKSGVGEHTARESEAPNVVRRERVRGEHPP |
| Ga0222756_10230701 | 3300022709 | Soil | MRSRTSHAAESGVGEHTARESESAQCVRWERARGERP |
| Ga0222756_10233471 | 3300022709 | Soil | MRPETTLAALSGVGEQTARESESAKRLRRERVRGEHPPP |
| Ga0222756_10240432 | 3300022709 | Soil | MRSRTSHAAKSGVGEHAARESESAQCMPWERACGER |
| Ga0222756_10241181 | 3300022709 | Soil | MRSRTSPAAKSGVGEHTARESECAQRMCRERASGERP |
| Ga0222756_10244182 | 3300022709 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPWERARGE |
| Ga0222756_10908951 | 3300022709 | Soil | MRSKTSHAAKSGVGEHAARESESAQCMSRERARGERPPP |
| Ga0242674_10175101 | 3300022711 | Soil | MRSTTSHAAVSSVGEHTARESECAQRVRRERVRGEH |
| Ga0242674_10180502 | 3300022711 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPRERACGERP |
| Ga0242653_10133981 | 3300022712 | Soil | MRSKTSHAAESSVGEHTARESEAPNSVRRERARGERPPPILAPGP |
| Ga0242653_10296911 | 3300022712 | Soil | MRSRTSHAAKSGVGEHAARESESAQRMPWERACGERPPP |
| Ga0242653_10319321 | 3300022712 | Soil | MRSTTSPAAKSGVGEHTARESECAQRVRRERVRGE |
| Ga0242671_10214572 | 3300022714 | Soil | MRSTTSHAAKSGVGEHTARESESAQCVRRERACGERPP |
| Ga0242671_10665291 | 3300022714 | Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVCGEYPPPNLAP |
| Ga0242678_10187151 | 3300022715 | Soil | MRSRTSPAAKSGVGEHTARESECAQRMCRERASGERPPPILAP |
| Ga0242678_10207862 | 3300022715 | Soil | MRSITSHAAESGVGEHTARESECAQRVRRERACGERPP |
| Ga0242678_10213612 | 3300022715 | Soil | MRSRTSHAARSGVGEHTARESESAQRMRWERARGERP |
| Ga0242673_10335131 | 3300022716 | Soil | MRSRTSHAAKSGVGEHAARESECAQRMPWERACGE |
| Ga0242673_10336241 | 3300022716 | Soil | MRSKTSHAARSGVGEHTARESESAKRMCRERARGER |
| Ga0242673_10474351 | 3300022716 | Soil | MRSRTSHAAKSGVGEHTARESESAQRVCWERARGERPP |
| Ga0242673_10639181 | 3300022716 | Soil | MRSKTSHAAKSGIGEHTARESECAQRMSRERARGERP |
| Ga0242661_10344041 | 3300022717 | Soil | MRSRTSHAAKSGVGEHTARESECAQCVCWERARGER |
| Ga0242675_10294991 | 3300022718 | Soil | MRSRTSHAAESSVGEHTARESEAPNSVRRERVRGEHPPP |
| Ga0242675_10316711 | 3300022718 | Soil | MRSITSLAAESGVGEHTARESECAQRVRRERACGER |
| Ga0242675_10324181 | 3300022718 | Soil | MRSKSSHAAKSGVGEHTARESECAQRMYWERVRGE |
| Ga0242675_10326622 | 3300022718 | Soil | MRSKTSHAAKSGVGEHTAREGESAQRVRRERVRGEHP |
| Ga0242672_10293501 | 3300022720 | Soil | MRSRTSPAAKSGVGEHTARESECAQRMCRERASGERPPPNLAL |
| Ga0242672_10300751 | 3300022720 | Soil | MRSKTSPAAKSGVGEQTTRESESAKRVCRERARGERPP |
| Ga0242672_10317292 | 3300022720 | Soil | MRSRTSHAAKSGVGEYPARESECAQRMRRERARGERP |
| Ga0242666_10966701 | 3300022721 | Soil | MRSRTSHAAKSGVGEHTASESECAQRVLRERACGER |
| Ga0242657_11144642 | 3300022722 | Soil | MRSKPALAALSGVGEHTARESESAKCVHRERVRGEHP |
| Ga0242665_101135432 | 3300022724 | Soil | MRSKTSHAAESSVGEHTARESEAPNSVRRERARGERPPP |
| Ga0242665_101162302 | 3300022724 | Soil | MRSKSSHAAKSGVGEHTARESECAQRMYWERVRGEHPP |
| Ga0242654_103050671 | 3300022726 | Soil | MRSITSLAAESGVGEHTARESECAQRVRRERACRER |
| Ga0247552_1009501 | 3300023536 | Soil | MRLRTSHAAKSGVGEHTARESECAQRMRWERARGERPPP |
| Ga0247541_1025611 | 3300023537 | Soil | MRSRTSHAAKSGVGEHTARESESAQCMSRERARGER |
| Ga0247555_1009811 | 3300023539 | Soil | MRLRTSHAAKSGVGEHTARESECAQRMRWERARGERPPPNLAP |
| Ga0247540_1011051 | 3300023542 | Soil | MRSTTSPAAKSGVGEHTARESECAQRVRRERACGERPPPNL |
| Ga0247540_1029101 | 3300023542 | Soil | MRLRTSHAAKSGVGEHTARESECAQRMRWERARGERP |
| Ga0247551_1014711 | 3300023552 | Soil | MRSKTSHAAKSGVGEHTARESESAQRVRRERVRGEHP |
| Ga0247551_1026011 | 3300023552 | Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVCGEYPPPNL |
| Ga0247530_1091511 | 3300023563 | Soil | MRSITSLAAESGVGEHTARESECAQRVRRERVRGER |
| Ga0247550_1012192 | 3300023660 | Soil | MRPNATLVALSGVGEHTARESESAQCVRRERVRGEH |
| Ga0247550_1013891 | 3300023660 | Soil | MRLRTSHAAKSGVGEHTARESECAQRMRWERARGER |
| Ga0247553_1028351 | 3300023672 | Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVCGEYPPPNLAPGP |
| Ga0247543_1014931 | 3300023677 | Soil | MRLRTSHAAKSGVGEHTARESECAQRMRWERARGERPP |
| Ga0228707_10425981 | 3300023700 | Freshwater | MRSKALLSAASGFGEHTARESESAKRMYRERASGERPPP |
| Ga0255299_10543781 | 3300028089 | Freshwater | MRSKSLHAAVSSVGEHTARESESAKCMHRERARGERP |
| Ga0255299_11066881 | 3300028089 | Freshwater | MRPIPLPAAVSSVGEHTARESESAQCVRRERARGER |
| Ga0257136_10442352 | 3300028619 | Marine | MRPTASHAAKSSVGKHTARESEAPNVCDWERARGERPPP |
| Ga0257139_10406382 | 3300028620 | Marine | MRPTAPHAAESSVGKHTARESEAPNVCEWERARGER |
| Ga0257141_10499781 | 3300028623 | Marine | MRPTASHAAESSVGKHTARESEAPNVCEWERARGERPP |
| Ga0265323_101690321 | 3300028653 | Rhizosphere | MRLKPSHAAKSGVGEHTARESESAQCVRLGRERGELPPPSLALE |
| Ga0257140_10448942 | 3300028668 | Marine | MRPTAPHAAESSVGKHTARESEAPNVCEWERARGERPPP |
| Ga0302220_101423171 | 3300028742 | Palsa | MRSKTSHAAKSGVGEHTARESECAQRMRWERARGERPPPNLAPEP |
| Ga0302279_100967081 | 3300028783 | Bog | MRSITSHAAKSGVGEHTARESESAQRVCRERARGERP |
| Ga0222749_103186451 | 3300029636 | Soil | MRSRTSHAAESSVGEHTARESEAPNSVRRERVRGEHP |
| Ga0222749_103219352 | 3300029636 | Soil | MRSRTSHAAKSGVGEYTARESECAQRMRRERARGERR |
| Ga0222749_103535001 | 3300029636 | Soil | MRSITSHAAVSSVGEHTARESECAQRVRRERVCGEH |
| Ga0257144_10305921 | 3300029638 | Marine | MRPTAPHAAESSVGKHTARESEAPNVCEWERARGERPP |
| Ga0206091_1077282 | 3300029655 | Soil | MRPKHPHAAESGVGEHTARESEAPNVCRRERARGERP |
| Ga0206091_1077431 | 3300029655 | Soil | MRPRHPHAADSGVGEHTARESEAPNVCRRERARGER |
| Ga0265604_1164752 | 3300029674 | Marine | MRPTASHAAKSSVGKHTARESEAPNVCDWERARGER |
| Ga0265599_10204732 | 3300029680 | Marine | MRPTASHAAKSSVGKHTARESEAPNVCDWERARGERP |
| Ga0222748_10518651 | 3300029701 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPRERARGERP |
| Ga0210267_10762911 | 3300030526 | Soil | MRSRTSHAAKSGVGEHTARESECAQRVRRERACGE |
| Ga0210285_12843312 | 3300030535 | Soil | MRSISSHAAESGVGEHTARESECAQCVRRERVCGEY |
| Ga0210266_10336431 | 3300030536 | Soil | MRSRTSHAAKSGVGEHTARESECAQRVRRERACGERPPPTLTPQPKG |
| Ga0210271_106618741 | 3300030545 | Soil | MRPNATLAALSGVGEHAARESESAKRVRRERVRGEHPP |
| Ga0210271_106945281 | 3300030545 | Soil | MRSRTSHAAKSGVGEHTARESECAQRVRRERACGERPPPNL |
| Ga0210260_101122551 | 3300030577 | Soil | MRPNATLAALSGVGEHAARESESAKRVRRERVRGE |
| Ga0210275_101026551 | 3300030578 | Soil | MRPNATLAALSGVGEHAARESESAKRVRRERVRSEHPPPIRKE |
| Ga0210255_104304891 | 3300030589 | Soil | MRSKSSHAAKSGVGEHTARESESAQRVRRERVRGEHPPPKC |
| Ga0210278_10537542 | 3300030596 | Soil | MRSRTSHAAKSGVGEHTARESESAQRVRRERACGEKK |
| Ga0210254_106856921 | 3300030602 | Soil | MRPNATLAALSGVGEHTARESESAQCVRRERVRGEH |
| Ga0210282_101171511 | 3300030630 | Soil | MRPNATLAALSGVGEHTARESESAQCVRRERVRGE |
| Ga0210279_101499021 | 3300030631 | Soil | MRPNATLAALSGVGEHAARESESAKRVRRERVRSEHPPP |
| Ga0210250_117754982 | 3300030632 | Soil | MRSRTSHAAKSGVGEHTARESECAQRVRRERACGERPPP |
| Ga0307921_10151692 | 3300030712 | Soil | MRSRSSHAAKSGVGEHTARESESAKRVCRERARGERPP |
| Ga0307921_10155012 | 3300030712 | Soil | MRSRTSHAAKSGVGEHTARESESAQRVRWERVRGEHP |
| Ga0307919_10264272 | 3300030718 | Soil | MRSRTSHAAKSGVGEHTARESESAQRVRWERVRGEH |
| Ga0307482_10882912 | 3300030730 | Hardwood Forest Soil | MRSITSHAAVSSVGEHTARESECAQRVRRERACGERPPP |
| Ga0307482_10898762 | 3300030730 | Hardwood Forest Soil | MRSKTSHAAESSVGEHTARESEAPNSVRRERARGERPPPIL |
| Ga0307482_10945392 | 3300030730 | Hardwood Forest Soil | MRSRTSLAAKSGVGEHTARESECAQRMRRERVRGERPP |
| Ga0307482_11003871 | 3300030730 | Hardwood Forest Soil | MRSKTSHAARSGVGEHTARESESAQCVRRERACGE |
| Ga0307482_13202161 | 3300030730 | Hardwood Forest Soil | MRSRASHAAKSGVGEHTARESESAKRVCRERARGERP |
| Ga0265460_110452071 | 3300030740 | Soil | MRPNATLAALSGVGEQTARESESAKRLRRERVRGE |
| Ga0138305_15607232 | 3300030758 | Soil | MRSKTSHAAKSGVGEHTARESDSAQRVRRERVRGEHPPPKQS |
| Ga0265745_10178441 | 3300030759 | Soil | MRSRTSHAAKSGVGEHTARESECAQRMRRERACGER |
| Ga0265762_10564132 | 3300030760 | Soil | MRSRTSHAAKSGVGEYTARESESAQRMRRERARGER |
| Ga0265775_1023581 | 3300030762 | Soil | MRSRTSHAAKSGVGEYTARESESAQRMRRERARGERP |
| Ga0265775_1040911 | 3300030762 | Soil | MRPNATLAALSGVGEHTARESESAQCVRRERVRGEHPP |
| Ga0265775_1042912 | 3300030762 | Soil | MRSRTSHAAKSGVGEHAARESESAQRMPWERACGE |
| Ga0265756_1151941 | 3300030805 | Soil | MRSITSLAAESGVGEHTARESECAQCVRRERACGER |
| Ga0265731_1006461 | 3300030806 | Soil | MRSRTSHAAKSGVGEHTARESESAHCVCRESARGER |
| Ga0265731_1013861 | 3300030806 | Soil | MRSRTSHAAKSGVGEYTARESESAQRMRRERARGERPP |
| Ga0265734_1038241 | 3300030812 | Soil | MRSRTSHAAKSGVGEHTARESECAQRMCRERASGERPPP |
| Ga0265729_1023321 | 3300030816 | Soil | MRSITSHAAKSGVGEHTARESESAQRVCRERARGER |
| Ga0265729_1037381 | 3300030816 | Soil | MRSKSSHAAKSGVGEHAARESESAQCMSRERARGERP |
| Ga0265726_1017161 | 3300030824 | Soil | MRSRTSHAAKSGVGEYTARESESAQRMRRERARGE |
| Ga0265736_1032221 | 3300030833 | Soil | MRSRTSHAAKSGVGEHTARESESAQRVCRERARGERPP |
| Ga0265738_1020441 | 3300030834 | Soil | MRSRPSHAAKSGVGEHTARESESAQRVRRERACGE |
| Ga0265767_1058471 | 3300030836 | Soil | MRSRTSHAAKSGVGELTARESESAKRKPWERVRGE |
| Ga0265767_1116771 | 3300030836 | Soil | MRSKSSHAAKSGVGEHTARESESAQRVRRERVRGEHPP |
| Ga0075393_109234132 | 3300030849 | Soil | MRSITSHAAVSSVGEHTARESECAQRVRRERVRGEHPPP |
| Ga0265753_10558481 | 3300030862 | Soil | MRSRSSHAARSGVGEHTARESESAQRVSRERVRGEHPPP |
| Ga0265753_10558521 | 3300030862 | Soil | MRSRTTHAAKSGVGEHTARESECAQRVRRERACGERPPP |
| Ga0265766_10097091 | 3300030863 | Soil | MRSRSSHAARSGVGEHTARESESAQRVSRERVRGEHPP |
| Ga0265742_10165491 | 3300030874 | Soil | MRSRTSHAAKSGVGEHTARESECAQRMCRERVRGEHPP |
| Ga0265727_1010052 | 3300030875 | Soil | MRSKPALAALSGVGEHTARESESAQCVHRERVRGEHPP |
| Ga0265777_1071072 | 3300030877 | Soil | MRSRTSHAAKSGVGELTARESESAKRKPWERVRGEHP |
| Ga0265765_10189621 | 3300030879 | Soil | MRSRSSHAAKSGVGEHTARESECAQRMCRERARGER |
| Ga0265776_1031231 | 3300030880 | Soil | MRSITSHAAKSGVGEHTARESESAQRVCRERARGERPPPEI |
| Ga0265776_1051101 | 3300030880 | Soil | MRSKSSHAAKSGVGEHAARESESAQCMSRERARGERPP |
| Ga0265758_1039151 | 3300030884 | Soil | MRSRPSHAAKSGVGEHTARESESAQRVRRERACGERPP |
| Ga0265772_1018091 | 3300030886 | Soil | MRSRTSHAAKSGVGEYTARESECAQRMRRERARGERP |
| Ga0265761_1030261 | 3300030889 | Soil | MRPNATLAALSGVGEHTARESESAQCLRRERVRGEHPP |
| Ga0265759_1027392 | 3300030913 | Soil | MRSKPALAALSGVGEHTARESESAQCVHRERVRGEH |
| Ga0265759_1050951 | 3300030913 | Soil | MRSRTSHAAKSGVGEHTARESECAQRVRRERARGERPP |
| Ga0138303_13576851 | 3300030939 | Soil | MRSTTSHAAKSGVGEHTARESECAQRMRRERACGERPPPNLLVP |
| Ga0074009_108433211 | 3300030944 | Soil | MRSKSSHAAKSGVGEHTARESESAQRVRRERVRGEK |
| Ga0099845_10090972 | 3300030975 | Boreal Forest Soil | MRSRSSHAAKSGVGEHTARESESAQCVPWERARGERP |
| Ga0099845_10114202 | 3300030975 | Boreal Forest Soil | MRSRTSHAAKSGVGEHTARESESAQCVPWERARGERPP |
| Ga0265748_1022011 | 3300030982 | Soil | MRPETTLAALSGVGEQTARESESAKRLRRERVRGEHP |
| Ga0265748_1023641 | 3300030982 | Soil | MRSIPSHAAKSGVGEHTARESESAQRVCRERVRGEH |
| Ga0265732_1027961 | 3300031016 | Soil | MRSRTSPAAKSGVGEHTARESECAQRMCRERASGERPPP |
| Ga0265754_10108721 | 3300031040 | Soil | MRSRTSHAAKSGVGEHTARESESAQRVRRERVRGEHP |
| Ga0265755_1040821 | 3300031041 | Soil | MRPNATLAALSGVGEHTARESESAQCVRRERVRGEHPPP |
| Ga0265755_1074771 | 3300031041 | Soil | MRSRTSHAAKSGVGELTARESESAKRKPWERVRGEH |
| Ga0265779_1031171 | 3300031043 | Soil | MRSTTSHAAVSSVGEHTARESECAQRVRREIVRGEHPPP |
| Ga0170834_1124171411 | 3300031057 | Forest Soil | MRSRTSHAAKSGVGEHTARESEAPNVCRWERARGERPPPNLAPEP |
| Ga0170822_104973031 | 3300031122 | Forest Soil | MRSRTSHAAKSGVGEHTARESECAQRVRRERACGEVEKEKKKG |
| Ga0170823_156776942 | 3300031128 | Forest Soil | MRSITSHAAVSSVGEHTARESECAQRVRRERVSGEHPPKPTKIKS |
| Ga0170824_1160170802 | 3300031231 | Forest Soil | MRSKTSHAAESSVGEHTARESEAPNSVRRERVRGEHPP |
| Ga0265329_100460393 | 3300031242 | Rhizosphere | MRSISSHAAESGVGEHTARESESAQCVRRERVRGEHPPP |
| Ga0170818_1151559221 | 3300031474 | Forest Soil | MRLRTSHAAKSGVGEYTARESECAQRMRRERARGERPP |
| Ga0314825_1053051 | 3300031490 | Soil | MRPRPPHAAESGVGEHTARESESAKQCAKEGARGER |
| Ga0307483_10100332 | 3300031590 | Hardwood Forest Soil | MRSITSHAAVSSVGEHTARESECAQRVRRERACGERP |
| Ga0307483_10108981 | 3300031590 | Hardwood Forest Soil | MRSKTSHAAKSGVGEYTARESECAQRMGRERARGER |
| Ga0310113_1159521 | 3300031636 | Soil | MRSKTSHAAKSGVGEHTARESECAQCMRRERARGER |
| Ga0307484_1048462 | 3300031663 | Hardwood Forest Soil | MRSRTSHAAKSGVGEHAARESESAQRMPWERACGERPP |
| Ga0307484_1048642 | 3300031663 | Hardwood Forest Soil | MRSKTSHAAGSSVGEHTARESEAPNSVRRERVCGEHP |
| Ga0307484_1113101 | 3300031663 | Hardwood Forest Soil | MRSRTSHAAESSVGEHTARESEAPNSVRRERVRGEH |
| Ga0307484_1137991 | 3300031663 | Hardwood Forest Soil | MRSITSLAAESGVGEHTARESECAQRVRRERACGERPPPTL |
| Ga0310118_1098711 | 3300031664 | Soil | MRSRPSHAAKSGVGEHTARESESAHRVRRERACGERP |
| Ga0307480_10049321 | 3300031677 | Hardwood Forest Soil | MRSRSSHAAESGVGEHTARESECAQRMRRERACGERP |
| Ga0310114_1126132 | 3300031678 | Soil | MRSITSHAARSSVGEHTARESECAQRVRRERACGERPPP |
| Ga0265342_106499111 | 3300031712 | Rhizosphere | MRSISSHAAESGVGEHTARESESAQCVRRERVRGEHPPPNL |
| Ga0316050_1024111 | 3300031829 | Soil | MRSTTSPAAKSGVGERTARESECAQRVRRERACGERP |
| Ga0316029_1043001 | 3300031870 | Soil | MRSKTSHAAKSGVGEHTARESESAQRVRRERVRGEHPPPNLA |
| Ga0316029_1055661 | 3300031870 | Soil | MRSITSLAAESGVGEHTARESECAQRVRRERVRGERPP |
| Ga0316036_1053282 | 3300031871 | Soil | MRSRTSHAAKSGVGEHTARESESAQCMSRERARGERP |
| Ga0316033_1101411 | 3300031872 | Soil | MRSKTSHAAKSGVGEHTARESESAQCMSRERARGERP |
| Ga0316035_1068351 | 3300031955 | Soil | MRSTTSPAAKSGVGEHTARESECAQRVRRERACGE |
| Ga0316035_1071571 | 3300031955 | Soil | MRSRTSHAAKSGVGEHTARESECAQRMCRERASGER |
| Ga0326631_1045031 | 3300032072 | Soil | MRSRTSHAAKSGVGEHTARESECAQRMRRERACGEH |
| Ga0316051_10088581 | 3300032119 | Soil | MRSRTSHAAKSGVGEYTAREIESAQRMRRERARGER |
| Ga0316040_1068241 | 3300032121 | Soil | MRSKTSHSAKSGVGEHTARESESAQRVRRERVRGEH |
| Ga0348332_122592731 | 3300032515 | Plant Litter | MRSTTSPAAKSGVGEHTARESECAQRVRRERACGERPPPNLTP |
| Ga0348332_141700012 | 3300032515 | Plant Litter | MRSKTSHAARSGVGEHTARESESAQCMRRERVRGEHPP |
| Ga0315742_111517391 | 3300032756 | Forest Soil | MRPNATLAALSGVGEHTARESESAQCVRRERVRGEHP |
| ⦗Top⦘ |