NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032759

3300032759: Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300032759 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128851 | Gp0330574 | Ga0314720
Sample NameMetatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size65433157
Sequencing Scaffolds28
Novel Protein Genes32
Associated Families30

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum6
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum3
Not Available12
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SaA2.131
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.3951Long. (o)-85.3736Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000392Metagenome / Metatranscriptome1188Y
F000459Metagenome / Metatranscriptome1109Y
F002974Metagenome / Metatranscriptome516Y
F007513Metagenome / Metatranscriptome349Y
F012546Metagenome / Metatranscriptome279Y
F018302Metagenome / Metatranscriptome235Y
F023028Metagenome / Metatranscriptome211Y
F026180Metagenome / Metatranscriptome198Y
F027090Metagenome / Metatranscriptome195Y
F028072Metagenome / Metatranscriptome192N
F030332Metagenome / Metatranscriptome185Y
F031344Metagenome / Metatranscriptome182N
F035610Metagenome / Metatranscriptome171Y
F036531Metagenome / Metatranscriptome169Y
F040424Metagenome / Metatranscriptome161Y
F040444Metagenome / Metatranscriptome161Y
F046814Metagenome / Metatranscriptome150N
F049431Metagenome / Metatranscriptome146N
F055475Metagenome / Metatranscriptome138Y
F060529Metagenome / Metatranscriptome132Y
F065366Metagenome / Metatranscriptome127Y
F067332Metagenome / Metatranscriptome125N
F068338Metagenome / Metatranscriptome124Y
F074257Metagenome / Metatranscriptome119Y
F085057Metagenome / Metatranscriptome111Y
F088054Metagenome / Metatranscriptome109N
F094644Metagenome / Metatranscriptome105N
F096411Metagenome / Metatranscriptome104Y
F100243Metagenome / Metatranscriptome102Y
F104214Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314720_1002631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1807Open in IMG/M
Ga0314720_1010496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1110Open in IMG/M
Ga0314720_1011178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes1080Open in IMG/M
Ga0314720_1012682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1025Open in IMG/M
Ga0314720_1012882All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1018Open in IMG/M
Ga0314720_1014685Not Available958Open in IMG/M
Ga0314720_1020305Not Available820Open in IMG/M
Ga0314720_1021141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum804Open in IMG/M
Ga0314720_1023044Not Available769Open in IMG/M
Ga0314720_1025753Not Available725Open in IMG/M
Ga0314720_1029970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum668Open in IMG/M
Ga0314720_1030243Not Available664Open in IMG/M
Ga0314720_1030567Not Available660Open in IMG/M
Ga0314720_1032610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa637Open in IMG/M
Ga0314720_1032787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum635Open in IMG/M
Ga0314720_1033699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SaA2.13625Open in IMG/M
Ga0314720_1034285All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae619Open in IMG/M
Ga0314720_1037710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
Ga0314720_1039130Not Available573Open in IMG/M
Ga0314720_1039764Not Available568Open in IMG/M
Ga0314720_1040891Not Available559Open in IMG/M
Ga0314720_1045237Not Available527Open in IMG/M
Ga0314720_1046064Not Available521Open in IMG/M
Ga0314720_1046357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum519Open in IMG/M
Ga0314720_1046740All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum517Open in IMG/M
Ga0314720_1048002All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
Ga0314720_1048150Not Available507Open in IMG/M
Ga0314720_1049290All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima500Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314720_1002631Ga0314720_10026312F028072LNLEVNTGKTVSTKKNINIRCRINSSEEHTWHTSHGQINLIVDLIHNFYITWGKRQDDLELKFERLQKEHKHLEEQYLVANKKLELALQAFEESKIFLRKISQNSDYIKRDISYLFNKLESTNIAEHSKEIVLSSSGILEVTRSLNSDK
Ga0314720_1010496Ga0314720_10104961F074257MGGVRIPVLFHWRESAEYDKAEFFSPKGKRVGVGSDKDKFSISLAISGRRISAELISPSCSRRAVSVLAGSIRWLEKPPDPLAMQTHEPNTKVVPALIAGKLNSKDAIEFFC
Ga0314720_1011178Ga0314720_10111783F100243SFGRLRGFLLKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGKW
Ga0314720_1012682Ga0314720_10126822F065366MLAVQLLVPSGCRWKSSIDVTVVVEFASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKTLTLCALVQL
Ga0314720_1012882Ga0314720_10128821F007513VALPVVLLVVFSTAMDHGTEALEEVSMLHAFLAVVFVSHTVDGTGDTLYLTLLTLL
Ga0314720_1014685Ga0314720_10146851F104214MWSMYCIEALGRLYRTTWLGGQVASPRDKEGYPGITTNPKLTISGVA
Ga0314720_1020305Ga0314720_10203051F067332SIHVYCHIIILANFGEDEIRRACIIISSCVEFWVFFFLVHPILTHSLRAYIAVLKFCAALLSIQLLAIQIIFLEKLDYEKDMRNYRFTYYRNFNDLRGMFIWISRLNLALDPVPSMLIVTTQ
Ga0314720_1021141Ga0314720_10211412F040444VTLDGLNGEAELSGHPGKEVEEGGEGLRLGAQRKSPRVMRKIINNDQIIFIARHAEYRRCPQVTVNKIKSMRSMRRRRRKRKSNMTT
Ga0314720_1021587Ga0314720_10215871F094644MKFIFLLXALRYQRYHSGIWHHCYCCSMPTKCSLHSGYCHTCALRLLCNSNTWILQIXGKDIHLPFASPSSGFQQRMXYCQNHKXLFTHSFIKDLRSMAIYIRMDALECGYHFPSENDQVXQISHFNKSVIVQIHEHRNAKSNIWLNYTSNSLETSEFFGIFXSSLQQATLEKVHISIGNNISLNSYYHMWYVVHYKNSMYLRHDIHILLPCLYMGFNQ
Ga0314720_1023044Ga0314720_10230441F000392MKTHIEYPDIFFXKYNSPYHFEMGTYVFINLLXAGGSVAPAQPTSLRXNXGIFAQTYSTCLEGPYRRDSSGAHPCRTIDMAXEPRIPSPCSLKAITHATGSKIGSSRSRWNRGTEYYPVGMKTHIEYPDIFFXKYDSPYHIYMGTYILIDLLXEGGSVAPAQPTSLRXN
Ga0314720_1025613Ga0314720_10256133F002974GRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP
Ga0314720_1025753Ga0314720_10257531F027090LFQDENALGPRLKPDKEYVHSWVTKEGQIISHDYRRNEISPDEPLLQPCLTIFGVRPPARAEDCQDKSEMRALSYELTKAHMANIRLDTSQQRLREEVREMQGDLDLYLEFLDERMDRLAKALGIQNFE
Ga0314720_1027369Ga0314720_10273691F000459VRSGVLKRVDKVKRGRGRPKLTWDESVKRDLKDWDISEELVLDRSAWRLSINVPEP
Ga0314720_1029970Ga0314720_10299701F030332MDLREQLAALFLGNAPHEDTIGATAVEIPFYHRVAFSQSYYALSGYIIFRKDVVFQVVPDLGDPCIGTSLSNWGWPYEVSGILGSAHDPWRAPRMECRRDH
Ga0314720_1030243Ga0314720_10302431F026180VHPTARHSAADCREIQKLAKRVSGRREQSSKDDSPPPRQRAGKEKASDSRAAAGEKELGYQSPARELKGVYHNDDSDSDNGDRRKKLYVMYGGSWELVSRRDVKTLRREVLSVKPGVPRAAPHQRWMNTTISFGPSDCPENMAGAGVLPL
Ga0314720_1030567Ga0314720_10305672F023028MSRMDPMRAWEWQDEVAGTSLVTRKFSSSIFCWKGLHKLQEGESKNTKDKPWLLHFGASGKGLSLAFYSHKGAY
Ga0314720_1032610Ga0314720_10326101F055475LFKTGFAQPQGRRPGLDPPLWHRGGPDEDITPTDTNDTPQDDIQGPITRARARQLNLQVSSFLSNVYCESENRLLPNDLIVLRNKGEDQQGCGEGLGGVEDQQGRPDQDGGPNRFDFVSVSDSRNRPH
Ga0314720_1032787Ga0314720_10327872F088054MHTDQATEIHLTRPFQQLHRYKIRQSILLATVTLASSFQLATVTTSFSFPWSIAIVVVDGDDGVVVVVVGAGEAADMGRIVATGQTPT
Ga0314720_1033699Ga0314720_10336991F036531LTISEKDLADLAFNGLRSYLKEKLEGFEYHTVNFLQVKVMGLEFKLKNAKDTFKPHRSNTHILDHDSDGSDDDSKEVYAAEFVWPSKAKPGSVPSLKPIQKNRQDEPKFTFDVSKCDRIFDELLKNGNIRLSHAIPSPDELKRHAY
Ga0314720_1034285Ga0314720_10342851F060529PNSKFKFEFKKMKNSQKNPKNISRCKESNDVKFSQKFVHLVWFVEFIS
Ga0314720_1037710Ga0314720_10377102F018302LTAIDLGNWGRDLVPLEGHQRSWQLAVVFKRALGSELQFYSSDRGGAFLLVIGGGTLPSAITFCHRPPRGRLRWSLLRLVSDGHTYPPLSFRWSPWDPGGCRCTGPVCRWCSPSVQEATKIKSPSLFQVENNKISRDVKGLFLGVRFISSRIISVIIRLQLEDELHGPRAACPGGM
Ga0314720_1039130Ga0314720_10391301F031344VENIGKKVKKSKRGSLIEGTSASAQQEDLEVNLPPPSSAYWSNEFQGASSGQGYPQGWTSQWEGSQEQAWGHAATAPPPFSNYGYPPSSYQGEMPDPSFGAQYFDLPQPEQGVRIMGAYARRNMEDIDVIRRHTTQLEDGTAGIAYQMGLLGLAPPEQFNRGAFQQYYDQGYNARANQGD
Ga0314720_1039764Ga0314720_10397641F096411CSQSWEEGKELEPLHLGAKGYHHQYEGALNGVGFKEDLKPKNGFGGFGCLAYKLKVKVQAKTS
Ga0314720_1040891Ga0314720_10408911F046814AFPARLRCVFLVLLPFFIPKLFFIQLMRRNRTYPYNWVVVKEKDNKQDNLGFGFWNPVDLMSCSNEEFSLPNIDGASNSEMKNTDMIIARN
Ga0314720_1042213Ga0314720_10422131F002974MLFFSPWGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVP
Ga0314720_1045237Ga0314720_10452371F035610MHESTIYLITLIELFVHIDRDKHSLRVLTPRETTKDNLANMLVSKSQAIE
Ga0314720_1046064Ga0314720_10460641F068338EVKFFQTLTKREGQVLTIAGRDAMIVGSGRATFILPMGTQIHIEEALLYPDSTRTLLSYRDIWKNGIHVETHEEHNEEFFLFTKNTGYGKQTLEKMPSLPSGLYYTYIKPVPHFAYKVIFQNVDTFKTWHERLGHPSWHRDDEKNHE
Ga0314720_1046357Ga0314720_10463571F007513VEVRETVVVTVLQRVVALPVVLLVIFSTAMDHGTEALEEVLRLHAFLAVVFVSHAVDGTGDTLCLVLLTLL
Ga0314720_1046740Ga0314720_10467401F085057GVSLAEQSLSLFSLAVIPCKREHQGRMEESGMAPRYLSWVLDHLVAASKVSRVSQEKWER
Ga0314720_1048002Ga0314720_10480022F040424FECNKEAIDHAATIRVPSSVSEILVVAKELSLKESMPSKKPSQSSVKPTSDVGTKTIQLQERDDSKTAIIGAELGDK
Ga0314720_1048150Ga0314720_10481501F012546MGSSLALSCNIRLFVIELDYGYRYLLEVGSELSDICFLIWLFYCSMLALHDRLVLEMISISCLELYQLL
Ga0314720_1049290Ga0314720_10492901F049431GRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.