NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040424

Metagenome / Metatranscriptome Family F040424

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040424
Family Type Metagenome / Metatranscriptome
Number of Sequences 161
Average Sequence Length 90 residues
Representative Sequence TGVLSLRGDLLKSFECDKEAIDHAATIRVPSSVSEILAAAKELSLKESMPSKKLSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK
Number of Associated Samples 99
Number of Associated Scaffolds 161

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.73 %
% of genes near scaffold ends (potentially truncated) 73.91 %
% of genes from short scaffolds (< 2000 bps) 98.76 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.137 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(72.050 % of family members)
Environment Ontology (ENVO) Unclassified
(91.925 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(78.261 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.42%    β-sheet: 11.86%    Coil/Unstructured: 62.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 161 Family Scaffolds
PF00078RVT_1 4.35
PF13456RVT_3 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.14 %
UnclassifiedrootN/A1.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005280|Ga0065696_1263823All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300005335|Ga0070666_10915606All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis649Open in IMG/M
3300005353|Ga0070669_101708618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis549Open in IMG/M
3300005367|Ga0070667_100652564All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum971Open in IMG/M
3300005841|Ga0068863_102438526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300009972|Ga0105137_101898All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis826Open in IMG/M
3300009972|Ga0105137_102558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum766Open in IMG/M
3300009975|Ga0105129_101625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1020Open in IMG/M
3300009975|Ga0105129_104279All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis796Open in IMG/M
3300009975|Ga0105129_109121All Organisms → cellular organisms → Eukaryota650Open in IMG/M
3300009975|Ga0105129_116449All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum550Open in IMG/M
3300009975|Ga0105129_121075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300009976|Ga0105128_119620All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum523Open in IMG/M
3300009980|Ga0105135_104424All Organisms → cellular organisms → Eukaryota893Open in IMG/M
3300009980|Ga0105135_111758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum685Open in IMG/M
3300009981|Ga0105133_109307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii722Open in IMG/M
3300009989|Ga0105131_121038All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis645Open in IMG/M
3300009990|Ga0105132_132585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300009993|Ga0105028_117899All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis761Open in IMG/M
3300009994|Ga0105126_1010867All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum869Open in IMG/M
3300009994|Ga0105126_1026342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum663Open in IMG/M
3300009995|Ga0105139_1043583All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum770Open in IMG/M
3300009995|Ga0105139_1060068All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum687Open in IMG/M
3300009995|Ga0105139_1075586All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum630Open in IMG/M
3300009995|Ga0105139_1083435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum604Open in IMG/M
3300009995|Ga0105139_1088747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum588Open in IMG/M
3300009995|Ga0105139_1096870All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum565Open in IMG/M
3300009995|Ga0105139_1098134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum562Open in IMG/M
3300009995|Ga0105139_1106669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum541Open in IMG/M
3300010371|Ga0134125_11778490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum670Open in IMG/M
3300010396|Ga0134126_12632160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum546Open in IMG/M
3300010399|Ga0134127_13160155All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300010401|Ga0134121_12796658All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum534Open in IMG/M
3300010401|Ga0134121_13214211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300013306|Ga0163162_13378311All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300014968|Ga0157379_11866041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum592Open in IMG/M
3300015270|Ga0182183_1078612All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum536Open in IMG/M
3300015273|Ga0182102_1007075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii817Open in IMG/M
3300015278|Ga0182099_1028718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300015280|Ga0182100_1070566All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300015280|Ga0182100_1085300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300015280|Ga0182100_1090750All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum520Open in IMG/M
3300015290|Ga0182105_1048030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum668Open in IMG/M
3300015290|Ga0182105_1058010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum627Open in IMG/M
3300015293|Ga0182103_1010746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta988Open in IMG/M
3300015297|Ga0182104_1084788All Organisms → cellular organisms → Eukaryota573Open in IMG/M
3300015297|Ga0182104_1085901All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum570Open in IMG/M
3300015301|Ga0182184_1067220All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii580Open in IMG/M
3300015309|Ga0182098_1105259All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015310|Ga0182162_1045002All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum736Open in IMG/M
3300015311|Ga0182182_1044342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii718Open in IMG/M
3300015312|Ga0182168_1123912All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis524Open in IMG/M
3300015313|Ga0182164_1077460All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum628Open in IMG/M
3300015313|Ga0182164_1112995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300015317|Ga0182136_1070208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300015317|Ga0182136_1103315All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300015318|Ga0182181_1017103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum949Open in IMG/M
3300015318|Ga0182181_1053852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum655Open in IMG/M
3300015318|Ga0182181_1093811All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum542Open in IMG/M
3300015324|Ga0182134_1052895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum741Open in IMG/M
3300015324|Ga0182134_1094455All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii600Open in IMG/M
3300015326|Ga0182166_1089033All Organisms → cellular organisms → Eukaryota606Open in IMG/M
3300015327|Ga0182114_1043303All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum837Open in IMG/M
3300015327|Ga0182114_1064650All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum726Open in IMG/M
3300015327|Ga0182114_1080946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis667Open in IMG/M
3300015327|Ga0182114_1126959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum558Open in IMG/M
3300015328|Ga0182153_1101709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii591Open in IMG/M
3300015328|Ga0182153_1123153All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300015329|Ga0182135_1046163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii791Open in IMG/M
3300015330|Ga0182152_1050930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum768Open in IMG/M
3300015330|Ga0182152_1073504All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum674Open in IMG/M
3300015330|Ga0182152_1080266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum652Open in IMG/M
3300015330|Ga0182152_1129677All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015330|Ga0182152_1132389All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum536Open in IMG/M
3300015331|Ga0182131_1080669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii653Open in IMG/M
3300015331|Ga0182131_1095664All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum612Open in IMG/M
3300015331|Ga0182131_1154146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300015332|Ga0182117_1106650All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum614Open in IMG/M
3300015332|Ga0182117_1127398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum570Open in IMG/M
3300015333|Ga0182147_1072203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum709Open in IMG/M
3300015333|Ga0182147_1116039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum590Open in IMG/M
3300015334|Ga0182132_1088084All Organisms → cellular organisms → Eukaryota659Open in IMG/M
3300015335|Ga0182116_1096816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300015335|Ga0182116_1136825All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum568Open in IMG/M
3300015335|Ga0182116_1155055All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300015336|Ga0182150_1074254All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum691Open in IMG/M
3300015336|Ga0182150_1084874All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300015336|Ga0182150_1137660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300015336|Ga0182150_1145345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum532Open in IMG/M
3300015337|Ga0182151_1085624All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis656Open in IMG/M
3300015337|Ga0182151_1131103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum555Open in IMG/M
3300015337|Ga0182151_1133904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum550Open in IMG/M
3300015337|Ga0182151_1166451All Organisms → cellular organisms → Eukaryota502Open in IMG/M
3300015338|Ga0182137_1101765All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum642Open in IMG/M
3300015338|Ga0182137_1119293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum601Open in IMG/M
3300015338|Ga0182137_1161947All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum525Open in IMG/M
3300015339|Ga0182149_1169205All Organisms → cellular organisms → Eukaryota508Open in IMG/M
3300015340|Ga0182133_1180247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum517Open in IMG/M
3300015348|Ga0182115_1188649Not Available661Open in IMG/M
3300015348|Ga0182115_1193797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis651Open in IMG/M
3300015349|Ga0182185_1192062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum616Open in IMG/M
3300015350|Ga0182163_1095174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum898Open in IMG/M
3300015350|Ga0182163_1133072All Organisms → cellular organisms → Eukaryota768Open in IMG/M
3300015350|Ga0182163_1180814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii660Open in IMG/M
3300015352|Ga0182169_1197961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300015352|Ga0182169_1247802All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum579Open in IMG/M
3300015352|Ga0182169_1255166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300015352|Ga0182169_1262401All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum560Open in IMG/M
3300015352|Ga0182169_1314194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300015353|Ga0182179_1246508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum576Open in IMG/M
3300015354|Ga0182167_1064099All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1293Open in IMG/M
3300015354|Ga0182167_1160016All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum830Open in IMG/M
3300015354|Ga0182167_1169016All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum805Open in IMG/M
3300015354|Ga0182167_1270779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum609Open in IMG/M
3300015354|Ga0182167_1335400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300015354|Ga0182167_1367706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300017408|Ga0182197_1091633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum610Open in IMG/M
3300017422|Ga0182201_1078351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300017422|Ga0182201_1130858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300017432|Ga0182196_1037974All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum814Open in IMG/M
3300017435|Ga0182194_1137405All Organisms → cellular organisms → Eukaryota526Open in IMG/M
3300017440|Ga0182214_1103782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum608Open in IMG/M
3300017445|Ga0182198_1160561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum552Open in IMG/M
3300017447|Ga0182215_1135778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum562Open in IMG/M
3300017691|Ga0182212_1085993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum701Open in IMG/M
3300017691|Ga0182212_1124035All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum585Open in IMG/M
3300017693|Ga0182216_1103894All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum683Open in IMG/M
3300017694|Ga0182211_1090871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum712Open in IMG/M
3300017694|Ga0182211_1126146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum605Open in IMG/M
3300017694|Ga0182211_1140800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum572Open in IMG/M
3300025923|Ga0207681_10855804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis761Open in IMG/M
3300028049|Ga0268322_1011756All Organisms → cellular organisms → Eukaryota828Open in IMG/M
3300028056|Ga0268330_1044931All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum568Open in IMG/M
3300028064|Ga0268340_1082943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300028143|Ga0268348_1020814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis541Open in IMG/M
3300028469|Ga0268337_1014925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum549Open in IMG/M
3300028523|Ga0268313_1011601All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum595Open in IMG/M
3300028525|Ga0268305_108486All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis566Open in IMG/M
3300028526|Ga0268339_1020553All Organisms → cellular organisms → Eukaryota508Open in IMG/M
3300032465|Ga0214493_1157676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M
3300032469|Ga0214491_1007960All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2057Open in IMG/M
3300032502|Ga0214490_1078073Not Available758Open in IMG/M
3300032548|Ga0214483_1060324All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum634Open in IMG/M
3300032551|Ga0321339_1138280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300032689|Ga0214497_1077382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum734Open in IMG/M
3300032697|Ga0214499_1012773All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2060Open in IMG/M
3300032699|Ga0214494_1111586All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300032759|Ga0314720_1048002All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300032760|Ga0314754_1047950All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum671Open in IMG/M
3300032761|Ga0314733_1083413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis606Open in IMG/M
3300032791|Ga0314748_1123390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300032811|Ga0314718_1037510All Organisms → cellular organisms → Eukaryota573Open in IMG/M
3300032821|Ga0314719_1030033All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum679Open in IMG/M
3300032875|Ga0314737_1065200All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300032889|Ga0314751_1089052All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300032914|Ga0314750_1029601Not Available1208Open in IMG/M
3300032916|Ga0314734_1069256All Organisms → cellular organisms → Eukaryota710Open in IMG/M
3300032976|Ga0314752_1016639All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1323Open in IMG/M
3300033533|Ga0314770_1138150All Organisms → cellular organisms → Eukaryota765Open in IMG/M
3300033535|Ga0314759_1154710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis730Open in IMG/M
3300033538|Ga0314755_1013021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1822Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere72.05%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated14.91%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere4.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.11%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.48%
Switchgrass Rhizosphere Bulk SoilHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005280Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soilHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009993Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028143Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028469Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028523Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028525Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028526Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032548Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032759Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032760Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032811Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032821Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032875Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032889Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032914Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032916Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032976Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033533Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033538Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0065696_126382313300005280Switchgrass Rhizosphere Bulk SoilDKEAIDHASTIRVPSSVSEILATAKELSLKESMPSKKPSQSLVKPTNGVGTKTIQLQEGDDSKTAIIRAGLGDK*
Ga0070666_1091560613300005335Switchgrass RhizosphereKSFECDKEAIDHAAIIRVPTSIREILATAKELSLNKDSMPSKKPSQSSVKPTGDVDTKIIQLQEGDDAKTAIIGAGLGDK*
Ga0070669_10170861823300005353Switchgrass RhizosphereDKEAIDHAATIQVPRSVSEILAAAKELSFKESMPSKKPNQSSVKPTGDVGTKTIQLQDGDDSKTAIIGAGLGDK*
Ga0070667_10065256423300005367Switchgrass RhizosphereMPGNTGVLSLRGDLLKSFEYDKEAIDHAATIRVPSSVSEILAAAKELSLKESMPSKKPTQSSVKPTSDVGTKIIQLQEGDDSKTAIIGAGLGDK*
Ga0068863_10243852613300005841Switchgrass RhizosphereGDLLKSFECDKEAIDHASTIRVPRSVSEILAAAKELSLKESMPSKKPSHSSVKPTGDVGTKTIQLQEGDDSKTAIIGARLGDK*
Ga0105137_10189823300009972Switchgrass AssociatedLLKSFKCDKKAIDHAATIRVPSSVCEILAAAKKLPLKESMPSKKSRQSSAKPTGDVATKTIQLQEGDDSKTAIIGAGLGDK*
Ga0105137_10255813300009972Switchgrass AssociatedGNTGVLSLRGDLLKPFECNKEVIDHAATIRVPSSVSEILAAAKELSLKELMPYKKPSQSSVKPTGDVGTNTIQLQEGDDSKIAIIGAGLGDK*
Ga0105129_10162513300009975Switchgrass AssociatedMPGNTGVLSLRGDLLKSFECDKEAIDHISTILVSSSVSEILADAKELSLKESMPSKKPSQSSVKSTGDGGTKTIQLQERDDSKTAIIGAGLGDK*
Ga0105129_10427913300009975Switchgrass AssociatedCDKEAMDHAATIRVPSSISEILAAAKELSLKESMPSKKPSQSLVKPTSDVGTKTIQLQEGDDSKTSIIGAGLGDK*
Ga0105129_10912113300009975Switchgrass AssociatedCDKEAMDHAATIRVPSSISEILAAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0105129_11644923300009975Switchgrass AssociatedPHYVYLLLKMPGNTGVLSLCGDLLKSFECDKEAIDHASTIRVPSSVSEILATAKKLSLKDSIPSKKPSHPSVKPTGDVGTKTIQLQEGDDSKTAIIETGLGDK*
Ga0105129_12107523300009975Switchgrass AssociatedMLGNTGVLSLRGDLLKSFECDKEAIYHAATIRVPSSVREILAAAKELSLKESMPSKKPSQLSVKPTGDVGTKTIQLQYGDDS
Ga0105128_11962023300009976Switchgrass AssociatedLLKMPGNTGVLSLRGDLLKSFECDKEAIDHAATIRVPSSVSEILAAAMELSLNKDSMPSKKPSQSSVKSAGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0105135_10442413300009980Switchgrass AssociatedMPDNTGVLSLRGDLLKSFKCDKEAIDHAATIRVPSSVSEILAAAKELSLDKDSMPSKKPSQSAVKPTSDVGTKTIQLQEGDDSKTAIIEAGLGDK*
Ga0105135_11175823300009980Switchgrass AssociatedMPGNTGVLSLCGNLLKSFECDKEAIIHASSIRVPSSVSEILVAAKELSLDNKDFVPSKRPSQSSVKPTNDVGTKTIQLQEGDESKTAIICTGLGDK*
Ga0105133_10930713300009981Switchgrass AssociatedMAIPHYVYLLLKMPGNTGILSLRGDLLKSFECDKEAIDHAATIRVPNSVNEILTAAKELSLNKDSTPSKKLSQSSVKPTGNVGTKTIKLQEGDDSKTAIIGAGLGDK*
Ga0105131_12103823300009989Switchgrass AssociatedLKSFECDKEAIDHAATIRVPSSVSEILAATKELSLKEPMPSKKPSQSSVKPTSDVGTKIIQLQEGDDSKTAIIGARLGDK*
Ga0105132_13258513300009990Switchgrass AssociatedGVLSLRGDLLKSFECDKEAIDHAATIRVPKSISKILAAAKELSLNKDSMPSKKPSQSSVKPTGDVGTKTIKLQEGDDSKTAIIGAGLGDK*
Ga0105028_11789913300009993Switchgrass AssociatedLKSFECDKEVIDHASTIRVPSSVSEILAAAKELSLKEPMPSKKPSQSSVKPTNGVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0105126_101086723300009994Switchgrass AssociatedMPGNMGVLSLRGDLLKSFECDTETIDHAATIRVPTSVSEILAAAMELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEEDDSKTAIIGASLGDK*
Ga0105126_102634213300009994Switchgrass AssociatedHRSTFLTWRPQVLPGNTGVLSLRGDLLKSFECDREAIDHATTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTTIIGAGLGDK*
Ga0105139_104358313300009995Switchgrass AssociatedMPSWEDQRWPFMVVPQYVYLFIKMPGNTGVLSLRGDLLKSFECDKEVIVHASSIRVPSPVSEILVATKELSLNKDSMPSKRPSQSSVKPARDMGTKTIQLQEGGDSKTAIIGPGLSDK*
Ga0105139_106006823300009995Switchgrass AssociatedMPRNIGVLSMREDLLKSFECDKEAIDHAATIRVPSSVSEILTAAKELSLNKDSVPSKKPSQSSVKPTGDVGTKTIQLQEGNDSKTAVIGSGLGDK*
Ga0105139_107558623300009995Switchgrass AssociatedLCGDLLKSFECDKEAIDHAATIRVPSSISKILTAAKELSFKESMPSKKPRQSSVKPTGDVGTKTIQLQEGDDSKRTIIGAGLGDK*
Ga0105139_108343513300009995Switchgrass AssociatedKEAIDHAATIRVPSSVSEILAAAKELSLNKDLMPSKKPSQSSVKPIGDVGTKTIQLQEGDDSKRTIIRAG*
Ga0105139_108874713300009995Switchgrass AssociatedVYLLLNMPGNIGVLSFHEDLLKFFEYDKEAFNHASSIPVPSSVSEILAAAKELSLNKDSMPSKRPSQSSVKPASDVGTKTIQLQEGDESKTAIIGTGLGNK*
Ga0105139_109687013300009995Switchgrass AssociatedGDLLKSFECDKEAIDHASTIRVPSSVSEILATAKELSLKESMPSKKPSQSSVKPTNGVGTKTIQLQEEDDSKTAIIGAGLGDK*
Ga0105139_109813413300009995Switchgrass AssociatedRGDLLKSFECDKEAIVHASSIRVPSSVSEILAVAKELLLNKDSMPSKKPSQSSVKPAGDVGTKTIQLQEGDDTKTAIIRAGLSDK*
Ga0105139_110666913300009995Switchgrass AssociatedLKSYECDKEAIDYASNILIPSTASEALAAAKELSMSKDSIPTKKPSQSAIKLTNDMGTKTIQLQEGHSSKTSIIGTG
Ga0134125_1177849013300010371Terrestrial SoilLLLKMPGNMRVLSLRGDLLKSFECDKEAIDHAATIRVPSSASELFAAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0134126_1263216023300010396Terrestrial SoilSLRGDLLKSFECDKEAIDHAATIRVPSSVSEILAAAKELSLKESTPSKKPSQSSVKPTNGMGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0134127_1316015513300010399Terrestrial SoilTGVLSLWGDLLKSFKCDKDAIDHASTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTNGVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0134121_1279665823300010401Terrestrial SoilGNTGVLSLRGDLLKSFKCDKETIDHASTIRAPSSVGEILAAAKELSLKELMPSKKPSQSSVKPTGDVGTKTIQLQEGDNSKTAIIGAGLGDK*
Ga0134121_1321421113300010401Terrestrial SoilMLGNTGVLSLRGDLLKSFECDKEAIDHAATFWVPSSVSEILAAAKELSLKESMPSKKPTQSSVKPTSDVGTKIIQLQEGDGSKTA
Ga0163162_1337831113300013306Switchgrass RhizosphereCQANTGVLSLQRDLLKSFECDKEAIDHAATIRVPSSVSEILAAAKELSLNKDSMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGTGLGDK*
Ga0157379_1186604113300014968Switchgrass RhizosphereMAIPHYVYLLLKMPGNTGVLSLCGDLLKSFKHDKEVIDHAATIRVPSSVSEILAAAKELSLNKDSMPSKKSTQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182183_107861223300015270Switchgrass PhyllosphereECDKEAIDHAATTRVPSSVSEILAAAKELSLKELMPSKKPTQILVKPTSDVGTKIIQLQEGDDSKTAIIGAGVGDK*
Ga0182102_100707513300015273Switchgrass PhyllosphereMAIPPYMYLLLKMPGNTGVLSLRGDLLKSFECDKEAIDHAATIRVPSSVNEILAAAKELSLNKDSMPSKKSTQSSVKLTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182099_102871823300015278Switchgrass PhyllosphereFECDKEAIDHASTIWVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKMAIIGAGLGDK*
Ga0182100_107056613300015280Switchgrass PhyllosphereLLLKMLGNTGVLSLRGDLLKSFECEKEAIDHASTIRVPSSVSEILAAAKELSLKESLPSKKPNQSSVKPTNGVGTKTIQLQKGDDSKTAIIGAGLGDK*
Ga0182100_108530023300015280Switchgrass PhyllosphereLLKMPSNTGVLSLRGDLLKSFEGDKEAIDHAATIRVPSSVSEILAVAKELSLKKLMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182100_109075013300015280Switchgrass PhyllosphereMLEIKLGCYTGNTGVLSLRGDLLKSFECDKEAIDLAATIRVRSSVSEILAAAKELSLNKDSMPSKKPSQSLVIPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182105_104803023300015290Switchgrass PhyllosphereGNTGVLSLRGDLLKSFECDKEAIDRAATIRVPSSVSEILAVAKELSLKESMPSKKTSQSSVKPTSDVGTKTIQLQEGDDSKIAIIGAGLGDK*
Ga0182105_105801033300015290Switchgrass PhyllosphereDLLKSFECDKEAIDCASTIRVPSSISEILAAAKELSLNKDSMPSKKPSQSLVIPTGDVGTKTIQLQEGDDSKTAIIGAGLSDN*
Ga0182103_101074613300015293Switchgrass PhyllospherePHYVYLLLKMPGNTGVLSLHGDLLKSFECDKEAIDHAATIRVPSFVSEILAVAKKLSLKESMPSKKPSQSLVKPTGDVGTKTIQLQEGDDSKTTIIGAGLGDK*
Ga0182104_108478823300015297Switchgrass PhyllosphereSFEYDKEAIDHAATIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182104_108590113300015297Switchgrass PhyllosphereDLLKSFEYDKEAIDHASTIWVPSSISEILAAAKELSLKESMPSIKQSQSSVKLTSDVGTKTIQLQEGDDSKIAIIGAGLGDK*
Ga0182184_106722013300015301Switchgrass PhyllosphereVYLLLKMPCNTGVLSLRGDLLKSFECDKEAIDHAATIRVPSCVSEILAAAKELSLNKDLMPSKKLSQSSVKPTSNIGTKTIQLQEGDDSKTAIIGADLEEKFELVNFLQVEECWCHLPARDIAVLC*
Ga0182098_110525913300015309Switchgrass PhyllosphereLRGDLLKSFECDKEAIDHAVTIRVHNSVSEILAAAKELSLNKDSMPSKKLSQSTVRPAGDVGTKTIQLQEGDDAKTAIIGARLGDK*
Ga0182162_104500223300015310Switchgrass PhyllosphereMCTCSSRCRAIQEYFSLRGDLLKSFECDKEAIDHAATIRAPSSVSEILAAAMELSLNKDSMPSKKSTQSSVKPTGDVGTKTIQLYEGDDSKTAIVGAGFGDK*
Ga0182182_104434213300015311Switchgrass PhyllosphereLKMPGNTGVLSLRGDLLKSFECDKEAIDHVATIRVPSSVSEILAAAKELFLNKDSTPSKKPSQSSVKPTSDVGTKTIQLQEGDDSKTAIIGIGLGNK*
Ga0182168_112391213300015312Switchgrass PhyllosphereDLLKSFECDKEAIDHAATIRVPSSISEILAAAKEFSLKESMPSKKRSQSSVKPTDDMGIKTIQLQEGDDSKTTIIGAGLGDK*
Ga0182164_107746013300015313Switchgrass PhyllosphereMPGNTGVLSLCGDLLKSFKCDKEAIDHASTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTNGVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182164_111299523300015313Switchgrass PhyllosphereGDLLKSFECDKEAIDHASTIWVPSSVSEILAAAEELSLKDSIPSKKPSHPSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182136_107020813300015317Switchgrass PhyllosphereTMWYLLLKVPGNTGVLSLRGYLLKSFECDKEAIDHAATIRVSSSVSEILAAAKELSLKETMPSKKPSQSSVKPTGNVGTKTIQLQEGDDSKTTIVGAGFGDK*
Ga0182136_110331513300015317Switchgrass PhyllosphereMPRNTGVLSLRGDLLKSFECDKKAIVHASSIRVPSSVSQILAAAKDLSLNKDSMPSKRPNQSSVKPAGDVGTKAIQLQEGDDSKAAIIGAGLGDK*
Ga0182181_101710313300015318Switchgrass PhyllosphereMLGNTGVLLNSLECDKEAIVHASSIRVPSSVSEILATIKELSLNKDSMPSKKSSQSSVKPAGDVGTKTIQLQEGDDCKTAIIRAGLGDK*
Ga0182181_105385223300015318Switchgrass PhyllosphereMPYWEDLLLKMPGNTGVLSLQGDLLKSFECDKEAIDHAATIRVPSSVSEILAAAKELSPKKDSMPSKKLSKSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182181_109381123300015318Switchgrass PhyllosphereKFMAGPHYVYLLLKMPGNTGVLSLCGDLLKSFECDKEAIVHASSIRVPSSVSEILATAKELSLNKDSMPSKKSSQSSVKPAGDVGTKTIQLQEADDSKTAVIGAGLGDK*
Ga0182134_105289523300015324Switchgrass PhyllosphereLSLRGDLLKSFECDKEAIDHAATIQVPCSASEILAAAKELSLKESMPSKKQSQSSVKPTGDVGTKTIQLQEGDDSMTAIIGVGLGDK*
Ga0182134_109445513300015324Switchgrass PhyllosphereYMYLLLKMPGNIGVLSMRGDLLKSFECGKEAIDHAATIRVPSSISEILAAAKELSLNKDSTPSKKSSLSPVKPTGNVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182166_108903323300015326Switchgrass PhyllosphereRGDLLKSFECDKEAIDHASTIQVPSLVSEILAAAKELSIIKDSMPSKKSSQSSIKPIGDVGTKTIQLKEGDDSKTAIIGAGLGDK*
Ga0182114_104330313300015327Switchgrass PhyllosphereMAIPHYVYLLLKMPGNTGVLSLRVDLLKSFECDKEAIDHAATIRVPSSVSEILAATKELSLNKDAMPSKKPSQSLVKPGGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182114_106465023300015327Switchgrass PhyllosphereMPGNTGVLSLRGNLLKSFKCDKESIVHTSSIRVPSSVSEILVAAKKLSLNKDSMPSKRPSQSSVKPASDVGTKTIQLQEGDESKTAIIGAGLSDK*
Ga0182114_108094613300015327Switchgrass PhyllosphereAIDHAPTIQVPRSVSEILAAAKELSLKESMPSKKTNQSSVKPTNGVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182114_112695913300015327Switchgrass PhyllosphereEAIGHASSIRVSSSMSEILAAAKELSLNKDSMPSKKPSQSSLKPAGDDGTKTIQLQEGDESKTAIIGAGLNDK*
Ga0182153_110170913300015328Switchgrass PhyllosphereMALPHYVYLLLKMPGNTGLLSLRGDLLKSFECDKEAINYAATIRVPSSVCEILAAAKEPSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIRAGL
Ga0182153_112315313300015328Switchgrass PhyllosphereTGVLSLRGDLLKSFECNKEAIDHAATIRVPSSISEILAAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182135_104616323300015329Switchgrass PhyllosphereMVVPHYVFLLLKMPGNTGALSLRGDLLKSFECDKKAIVHASSIQVPSSVSEILAAAKELSLNKDSMPSKRPNQSSVKPAGDVGTKTIQLQEEDESKTAIIGAGLSNK*
Ga0182152_105093013300015330Switchgrass PhyllosphereMSFECDKAAIVHASSIRVPSSVSEILAATKELSLNKDSMPSKKSSQSLVKPVGDVGTKTIKLQVGDDSKTAIIGAG
Ga0182152_107350423300015330Switchgrass PhyllosphereMPGNTGVLSLCGDLLKSFECDKEAIDHAATIQVSSSISEILAAAKELSLNKNSMTSKKPSQSSVKPTGDVGTKTIQLHEGDDSKTAIIGAGLGDK*
Ga0182152_108026613300015330Switchgrass PhyllosphereVLQDLLESFECGKEAIDHVATIRVPSSVSKILAAAKELSLKESMPSKKPSQSSVRPTGDVGTKTIQLQEGDDSKTAIIGARLGDK*
Ga0182152_112967723300015330Switchgrass PhyllosphereGALLKSFECNKEASVHVSTIRVPSSVSEILAAAKELSLNKDSMPSKKSSQSSIKPAGDVGTKTIQLQEGDDSKTAIIGTGLGNK*
Ga0182152_113238913300015330Switchgrass PhyllosphereMLLKMPVNTGVLSLCGDLLKSFECDKEAIVHASTIRAPSSVSEILAAAKELSLKEPMPSKKPSHSSVKPTGDIGTNTIQLQEGDDSKTTIIGAGLGGK*
Ga0182131_108066923300015331Switchgrass PhyllosphereMAVPHSVYLHLKMPGNTGVLSLCDDLLKSFECDKEAIVHASSIRVPSSVRNILAAIKELSLNKDSMPSKRPNQSSVKPAGDVGTKTIQLQEEDESKTAIIGAGLSN
Ga0182131_109566423300015331Switchgrass PhyllosphereMPGTTGVLSLRGDLLKSFECDKEAIVHASSIRVPSSVSEIFSAAKELSLEKDSISKKPSQLSVKLAGDIGTKTIQLQEGDDSKTTIIREGLSDK*
Ga0182131_115414623300015331Switchgrass PhyllosphereVYLLLKMPGNTGVLSLRGDLLISFECDKEAIDHAATIRVPSSVSEILAAAKELSLTKDSTPSKKLSQSSVKPTGDMGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182117_110665013300015332Switchgrass PhyllosphereYLLLKMPGNTGVLSLPGDHLKSFECDKKAIDHAATIQVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIRAGLGDK*
Ga0182117_112739813300015332Switchgrass PhyllosphereKSFECDKKAIDHAATTRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182147_107220323300015333Switchgrass PhyllosphereMPGNTGVLSLRGDLLMSFECDKEAIDHTATIRVPSSVSEILAAAKELSLKESMPSKKSSQSSVKPTGDVGTKTIQLQEGDDSKTTIIGAGLGDK*
Ga0182147_111603913300015333Switchgrass PhyllosphereTGVLSLRGDLLKSFECDKEAIDHAATIRVPSSVSEILAAAKELSLKESMPSKKLSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182132_108808423300015334Switchgrass PhyllosphereEAIDHAATIRVSSSVSEILAAAKELSLNKNSMPSKKPSQSSVKPTDDVGTKTIQLQEGDDSKTAIIGEGLGDK*
Ga0182116_109681613300015335Switchgrass PhyllosphereHGDLLKSFECDKEAIDHASTIRVPSSVSEILAAAKELSLNKDSMPSKKPSQSSVKPADDVGPKTIQLQEGDDSKTAIIRAGLGDK*
Ga0182116_113682513300015335Switchgrass PhyllosphereVYLLLKMPGNIGVLSLRGDLLKSFECDKEAIDHASTIRVPSSVSEILATTNELSLKDSIPSKKPSHSSVKPTGDVGTKTIQLQEGDDSKTAIIGTGLGDK*
Ga0182116_115505513300015335Switchgrass PhyllosphereRGDLLKSFEYDKKAIDHASTVRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTNDVGTKTIQLQEGDDSKTAIECVCFCL*
Ga0182150_107425423300015336Switchgrass PhyllosphereSLRGDLLKSFECDKEAIDHVSTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTNGVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182150_108487423300015336Switchgrass PhyllosphereMPSNTAVLSLRGDLLKSFECDKEAIVHASSIPIPSSMSEILAATKELSLNKDSMPSKKSGQSSVKPAGDVGTKTIQLQEGDDSKTAIIGGGLSDK*
Ga0182150_113766023300015336Switchgrass PhyllosphereISLRGDLLKSFECDKEAIDHASTIRVPSSVSEILAAAEELSLKDSIPSKKPSHSSVKPTGDVGTKTIQLQEGDDSKTAIIGTGLGDK*
Ga0182150_114534513300015336Switchgrass PhyllosphereFECDKEAIDHVATIRVPSSVSEILAAAKELSLNKDSTPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIEAGLGDK*
Ga0182151_108562413300015337Switchgrass PhyllosphereCDKEAIDHASTIRVPSSVSEILAAAKKLSLKDSIPSKKPSHSSVKPTGDVGTKTIQLQEGDDSKTAIIGTGLGDK*
Ga0182151_113110313300015337Switchgrass PhyllosphereKCDKESIVHTSSIRVPSSVSEILVAAKKLSLNKDSMPSKRPSQSSVKPASDVGTKTIQLQEGDESKTAIIGAGLSDK*
Ga0182151_113390413300015337Switchgrass PhyllosphereLLKMSGNAGVLSLRGDLLKSFECDKEAIDHASTIRVPSCVSKILAAAKELSLNKDLMTSKKPSQSLVKPTGDIGAKTIRLQEEDDSKTAIIRAGLGDE*
Ga0182151_116645113300015337Switchgrass PhyllosphereRGDLLKSFECDKEAIDHAATIRVPSSVSEILAAAKELSLNKDSMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIRAGLGDK*
Ga0182137_110176523300015338Switchgrass PhyllosphereLRGDLLKSFECDKEAIDYAATIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDNSKTANIGAGLGDK*
Ga0182137_111929323300015338Switchgrass PhyllosphereMPGNTGVLSLRGDLLKSFECNKEAIDHASTIRVPSSVSEILAAAKELSLNKDSMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGASLSDK*
Ga0182137_116194713300015338Switchgrass PhyllosphereLSLRRDLLKSFECNKEAIDHASTIRVPSSVSEILAAAKELSLKESMASKKPSQSSVRPTNGVGTKTIQLQEGDDSKTAIIRAGLGDK*
Ga0182149_116920513300015339Switchgrass PhyllosphereDLLKSFECYKEAIDYAATIRVPSSVSEILTAAKKLSLKESMLSKKPSQSSVKPTSDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182133_118024713300015340Switchgrass PhyllosphereMPGNTGVLSLRGDLLKSFECDKEAIDHAATIRVPSSISKILAAAKKLSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTTIIAAGLGDK*
Ga0182115_118864923300015348Switchgrass PhyllosphereRGDLLKSFECNKEASVHVSTIRVPSSVSEILAAAKELSLNKDSMPSKKSSQSSVKPAGDVGTKTIQLQEGDNSKTAIIGAGLSDK*
Ga0182115_119379713300015348Switchgrass PhyllosphereECDKEAIDHAATIRVPSSVSEILAAAKELSLKELMPSKKPSQSSAKPTGDVGTKTIQLQEGVDSKTAIIGAGLGDK*
Ga0182185_119206223300015349Switchgrass PhyllosphereVYLLLMMPGNIGVLSLRGDLLKCFECNKEAIEHAATIRVPSSVSEILAVAKELSLNKDSTPPKKSSQLSVKPTGSVGTKTIQLQEGDDSKSARQIGTRACQLP*
Ga0182163_109517423300015350Switchgrass PhyllosphereMSFECVKEAIDHAATIRVPSSVNEILAAAKELSLNKDSMPSKKSSQLTVKPTSDVGTKTIQLQEGDDSKTSIIGAGLGNK*
Ga0182163_113307213300015350Switchgrass PhyllosphereVFLAPSSPRAVDPYLNSFECDKEAIDHAATIRVPSSVSEILDATKELSLNKDSTPSKKLSQPSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182163_118081413300015350Switchgrass PhyllosphereHLLLKMLGNTGVLSLRGDLLKSFECNKKAIDHAATIRVPSSVSEILAAAKELSLNKDSMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182169_119796123300015352Switchgrass PhyllosphereSLRGDLLKSFECNKKAIDHTSTVRVPSSVSKILAAAKELSFNKDSMPSKKPSQSSVKPAGDMGTKTIQLQEGDDSKTAIIGAGLGNK*
Ga0182169_124780213300015352Switchgrass PhyllosphereVLSLRGDLLKSFECDKEAIDHASTIRVPSSVSEILAAAKELSLKESMPSKKPSQPSVKPINGVGTKTIQLQEGDDSKTAIIGVGLGDK*
Ga0182169_125516623300015352Switchgrass PhyllosphereMPGNTGVLSLRGDLLKSFKCDKKAIDHASTIRVPSSISEILAASKKFSLKESMPSKKPSKSSDIPTGDVGTKTIQLQEGDDSKTAIIRAGLGDK*
Ga0182169_126240123300015352Switchgrass PhyllosphereMPGNTGVLSLCGDLLKSFECDKEAIDHAATIRVHSSVSEILAAAKELSLKESMPSKKPSQSSVRPTGDVGTKTIQLQEGDDSKTAIIRAGLGDK*
Ga0182169_131419413300015352Switchgrass PhyllosphereMAGSTGVLSLRGNLLKSFKCDKESIVHTSSILVPSSVSEILVAAKKLSLNKDSMPSKRPSQSSVKPASDVGTKTIQLQEGDESKTAIIGAGLSDK*
Ga0182179_124650813300015353Switchgrass PhyllosphereMLEIKLGCYTGNTGVLSLRGDLLNSFECDKGAIDHAATIRVPTSISEILAAAEELSLNKDSVPSKKPSQSPIKLTGDVGTKTIQLQEGDDSKTTIIGARLGDK*
Ga0182167_106409913300015354Switchgrass PhyllosphereMAVPHSVYLHLKMPGNTGVLSLCDDLLKSFECDKEAIVHASSIRVPSSVRKILAAIKELSLNKDSMPSKRPSQSSVKPASDVGTKTIQLQEG
Ga0182167_116001613300015354Switchgrass PhyllosphereMPGNTGVISLRGDLLKSFECDKEAIDHASTVRVPSSVSEILVSAKELSLNKNSMPSKKPSQSSVKPAGDMGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182167_116901623300015354Switchgrass PhyllosphereMVVPHYVNQLLKMPSNTVVLSLRGDLLKSFECDKEAIVYASSIPIPSSVSEILAATKELSLNKDSMPSKKSGQSSVKPAGDVGTKTIQLQEGDDSKTAIIGAGLSDN*
Ga0182167_127077923300015354Switchgrass PhyllosphereMPGNIGVLSMREDLLKSFECDKEAIDHAATIRVPSSVSEILAAAKELSLNKDLMPSKKLSQSSVKPTSNIGTKTIQLQEGDDSKTAIIGAGLGDK*
Ga0182167_133540013300015354Switchgrass PhyllosphereVLSLCGDLLKSFECDKEAIDRAATTRVPISVSEILAAAMELSLKESMPSKGPSQSSIKPTGDVGTKTIQLQEGDDSKTAIIRAGLGNK*
Ga0182167_136770613300015354Switchgrass PhyllosphereTGVLSLRGDLLKSFECDKEAIDHASTIRVPSSVSEILTASKELSLNKDSMPSKKSSQSSVKPTGDMGTKTIQLQEGDDSKTAIIRAGLSDK*
Ga0182197_109163313300017408Switchgrass PhyllosphereRGDLLMSFECDKEAIDHASTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGASLSDK
Ga0182201_107835113300017422Switchgrass PhyllosphereGVLSLRGYLLKSFECNREAIDHASTIRVPSSVSEKLAAAKKLSLNKDTMPSKKSSQSSVKPTRDVGTKTIQLQEGDDSKTAIIGAGLSDK
Ga0182201_113085813300017422Switchgrass PhyllosphereKEAIDHVATIRVPSSVSEILAAAKELSLKESMPSKKPNQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLIDK
Ga0182196_103797423300017432Switchgrass PhyllosphereMRADLLKSFESDKETIDHASTIRVPSSVSEIIAAAKELSLNKDSMPSKKPSQSSVKPAGDMGTKTIQLQEGGDSKTPIIGAGLSDK
Ga0182194_113740513300017435Switchgrass PhyllosphereRGDLLKSFECDKKAIDHAATIRVTGSISEILAATKELSLKESMPSKKPNQSSVKPTGDVGTKTIQLQEGGDSKTPIIGAGLSDK
Ga0182214_110378213300017440Switchgrass PhyllosphereLLKMPGNKGVLSLRGDLLKSFECDKEVIDHASTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTNGVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0182198_116056113300017445Switchgrass PhyllosphereSSICQATQGLLSFQGDLLKSFECDKEPVDHASNIRVPSTISKMLTAAKELSLTKDSIPSKKRSQSSVKPTSDVGTKTIQLQGDESKTAIISVT
Ga0182215_113577823300017447Switchgrass PhyllosphereGKEAIDHAATIRVLSSVSKILAAAKELSLNKDSMPSKKPSQSSVKPTGDIGTKTIQLQDGDDSKTAIIGAGLRDK
Ga0182212_108599313300017691Switchgrass PhyllosphereFECDKEFIDHAATIRVPSSVSEILDAAKELSLNKDSTPSKKSSQSSVKPTGNMGTKTIQLQGDDSKTAIIGARLGDK
Ga0182212_112403513300017691Switchgrass PhyllosphereFECDKEAIDHASTIRVPSSVSEILAAAKELSLNKDSMPSKKPSQSSVKPTGDVGTKTIQLQEGDNSKTAIIGAGLGDK
Ga0182216_110389423300017693Switchgrass PhyllosphereMPRNTGVLSLRGDLLKSFECDKKAIVHASSIRVPSFVSQILAAAKDLSLNKDSMPSKRPNQSSVKPAGDVGTKTIQLQEEDEFKTAIIGAGLSNK
Ga0182211_109087113300017694Switchgrass PhyllosphereMPGNTGVLSLRGDLLKSFEYDKEAIDHAATIRVPSSVSEILAAAKELSLKESMPSKKQSQSSVKPTGDVGTKTIQLQEGDDSKTTIIGAGLGDK
Ga0182211_112614613300017694Switchgrass PhyllosphereLSLCGDLLKSFECNKEAIDHAATTRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTDDVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0182211_114080023300017694Switchgrass PhyllosphereMSGNTGVLSLCGDLLKSFECDKEAIDHAATIRVPSSISEILAAAKELSLKESMPSKKPSQSSVKPTSDVGTKTIHLQDGDDSKTAIIGAGLGDK
Ga0207681_1085580423300025923Switchgrass RhizosphereECNKKAIDHASTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTNGVGTKTIQLQEGDDSKTAIFGAGLGDK
Ga0268322_101175633300028049PhyllospherePHYVYLLLKMPGNTGVLSLPGDLLESFECDKEAIVHASSIRVPSSVSEILAAAKELSLNKDLMPLKKSSQSLVKPAGDVGTKTIQLQEEDDSRTAIIGAGLSN
Ga0268330_104493113300028056PhyllosphereSLRGDLLKSFECDKEAIDHAATIRVPSSVSEILAAAKELSLNKDSMPSKKTSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0268340_108294323300028064PhyllosphereLFLKMPGNTGVLSLCGDLLKSFECDKEAIDHAATIRVPSSVSEILAAAEELSLKESMPSKKQSQSSVKPTSDVRTKTIQLQEGDDSKTAIIGARLGDK
Ga0268348_102081423300028143PhyllosphereEDLLKSFECDKEAIDHASTIRVPSSVSEIFAAAKELSLKESMPSKKPSQSSVKPTNGVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0268337_101492513300028469PhyllosphereYVYQLLKMPRNTGVLSLRGDLLKSFECDKEAIDHATTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTGTKTIQLQEGDDSKTDIIGAGLGDK
Ga0268313_101160123300028523PhyllosphereLSLWGDLLKSFECDKEAIDHASTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTNGVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0268305_10848623300028525PhyllosphereKEAIDHASTIRVPSSVNEILAAAKELSLKESMPSKKPSQSSVKPTNGVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0268339_102055313300028526PhyllosphereLKSFECDKEAIDHASTIRVPSSVSEILAAAKELSLKESMPSKKPSLSSVKPTNGVGTKTIQLQEGDDSKTTIIGAGLGDK
Ga0214493_115767613300032465Switchgrass PhyllosphereGNTGALSLRGDLLKSFECDKKAIVHASSIRVPSSVSEILAAAKELSLNKDSMPSKRPNQSSVKPAGDVGTKTKQLQEEDEFKTAIIGAGLSNK
Ga0214491_100796013300032469Switchgrass PhyllosphereLLKSFECDKEAIDHAATIRVPSSVSEILAAAKELSLKKSMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGVGLGDK
Ga0214490_107807313300032502Switchgrass PhyllosphereNTGVLSLRGDLLKSFECDKEAIDHVATIRVPSSVNEILAAAKELSLNKDSVPSKKPSQSSVKPTGDVGTKTIQLQEGNDSKTAVIGAGLGDK
Ga0214483_106032413300032548Switchgrass PhyllosphereLSLRGDLLKSFECDKEAIDHASTIRIPSSVSEILAAAKELSLKDSIPSKKPSHSSVKPTGDVGTKTIQLQEGDDSKTAIIGTGLGDK
Ga0321339_113828023300032551Switchgrass PhyllosphereMPGNIGVLSLRGDLLKSFECDKEAIDHAATIRVPSSVSEILAVAKELSLNNDSTPSKKSSQSSVKPTSNMGTKTIQLKEGDDSKTAVIGVGLGDKKELELVNFLRANRDVF
Ga0214497_107738223300032689Switchgrass PhyllosphereMMPGNTGVLSLRGDLLKSFECDKEAIDHAATIRVPSSVSEILAVAKELSLNNDSTPSKKSSQSSVKPTGNVGTMTIQLQEGDDSKTVVIRVGLGDK
Ga0214499_101277313300032697Switchgrass PhyllosphereKSFECDKESIDHASTIWVPSSVSEILAAAKELSLKESMPSKKPRHSSVKPSGDVGTKTIQLQEGDDSKTAIIGTGLGYK
Ga0214494_111158613300032699Switchgrass PhyllosphereNAGQVHGSTTLCVPTLKIPGNTGVLSLRGDLKSFECDKEAIDHAATIRVPSSVSEILTVAKELSLNKDSTPSKKSSQSSVKPTGNVGTMTIQLQEGDDSKTVVIRVGLGDK
Ga0314720_104800223300032759Switchgrass PhyllosphereFECNKEAIDHAATIRVPSSVSEILVVAKELSLKESMPSKKPSQSSVKPTSDVGTKTIQLQERDDSKTAIIGAELGDK
Ga0314754_104795013300032760Switchgrass PhyllosphereGVLSLRGDLLKSFKCDKKAIDHAATILVPSSVSEILAVAKELSLKESMPSKKPSQSSVKPTSDVGTKTIQLQEGDDSNTAIIRAGLGNK
Ga0314733_108341323300032761Switchgrass PhyllosphereCDKEAIDHAATIRVPSSVSEILDAAKELSLKESKPSKKPSQSSVKPTDDVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0314748_112339013300032791Switchgrass PhyllospherePGNTGVLSLRGDLLKSFECDKKTIDHAATIRVPSSVSEILAAAKELSLKESMPSKKLSQSSVKPTSDVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0314718_103751013300032811Switchgrass PhyllosphereDKEAIDHASTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSDKPTDDVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0314719_103003313300032821Switchgrass PhyllosphereGNTGVLSLRGDLLKSFECDKEAIDHASTIWVPSSVSKILAAAKELSLKESMPSKKPSKSSVKPTNGVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0314737_106520013300032875Switchgrass PhyllosphereNIGVLSLRGDLLKSFECDKEAIDHAATIRVPSTVSEVLAATKELSLKESMPSKKPSQSSVKPTSDVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0314751_108905223300032889Switchgrass PhyllosphereMSTCSSRCQSTRVLSLRGDLLKSFECDKKTIDHAATIRVPSSVSEILAAAKELSLKESMPSKKLSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0314750_102960113300032914Switchgrass PhyllosphereLESFECDKEAIDHAATIRVPSSVIEILAAAKELSLKESMPSKKPSQSLVKPTGDVGTKTIQLQEGDDSKTAIIGVGLGDK
Ga0314734_106925613300032916Switchgrass PhyllospherePHYIYLLLKMPGNTGVLSLRGDLLESFECDKEAIVHTSSIRVPSSVSEILAATKELSLNKDLMPSKKPNQSSVKPAKDVGTKTIQLQEGEDSKTAIIGAGLSDK
Ga0314752_101663913300032976Switchgrass PhyllosphereGVLSLRGDLLKSFECDKKAIDHADTIRVPSSVSEILAAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEGDDSKTVIIGAGLGDK
Ga0314770_113815023300033533Switchgrass PhyllosphereLRGDLLKSFECDKEAIDHAATIRVPSTVSEVLAATKELSLKESMPSKKPSQSSVKPTSDVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0314759_115471013300033535Switchgrass PhyllosphereLKSFECDKEAIDHAATIRVPSSASEILVAAKELSLKESMPSKKPSQSSVKPTGDVGTKTIQLQEVDDSKTAIIGAGLGEK
Ga0314755_101302123300033538Switchgrass PhyllosphereMPGNTGFLSLRGDLLKSFECDKESIDHASTIWVPSSVSEILAAAKELSLKESMPSKKPRHSSVKPSGDVGTKTIQLQEGDDSKTAIIGTGLGYK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.