NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060529

Metagenome / Metatranscriptome Family F060529

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060529
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 48 residues
Representative Sequence ETGPNSKFKFEFKKMKNSQKIPKNTSRCDESNGVKFSPKFVHLVWFAEFIS
Number of Associated Samples 92
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 3.23 %
% of genes near scaffold ends (potentially truncated) 92.42 %
% of genes from short scaffolds (< 2000 bps) 90.91 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (62.121 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(70.454 % of family members)
Environment Ontology (ENVO) Unclassified
(89.394 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(73.485 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.71%    β-sheet: 0.00%    Coil/Unstructured: 63.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF02892zf-BED 3.79
PF00069Pkinase 1.52
PF00078RVT_1 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 6.06


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A62.12 %
All OrganismsrootAll Organisms37.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005347|Ga0070668_101174998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis694Open in IMG/M
3300005355|Ga0070671_101263687Not Available651Open in IMG/M
3300005618|Ga0068864_100362273All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1370Open in IMG/M
3300005843|Ga0068860_102579043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae527Open in IMG/M
3300009553|Ga0105249_12346184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum606Open in IMG/M
3300009553|Ga0105249_12660989Not Available572Open in IMG/M
3300009973|Ga0105136_104073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis779Open in IMG/M
3300009973|Ga0105136_112039Not Available536Open in IMG/M
3300009981|Ga0105133_132031Not Available503Open in IMG/M
3300010371|Ga0134125_11819258Not Available662Open in IMG/M
3300010396|Ga0134126_11833877Not Available664Open in IMG/M
3300010403|Ga0134123_11884380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae653Open in IMG/M
3300012949|Ga0153798_10267372Not Available566Open in IMG/M
3300014326|Ga0157380_12027634Not Available637Open in IMG/M
3300014968|Ga0157379_12147390Not Available554Open in IMG/M
3300015270|Ga0182183_1005437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1128Open in IMG/M
3300015273|Ga0182102_1023862Not Available606Open in IMG/M
3300015273|Ga0182102_1041816Not Available521Open in IMG/M
3300015280|Ga0182100_1004571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1276Open in IMG/M
3300015280|Ga0182100_1018971Not Available860Open in IMG/M
3300015280|Ga0182100_1030995Not Available742Open in IMG/M
3300015280|Ga0182100_1036183All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300015284|Ga0182101_1057870Not Available608Open in IMG/M
3300015284|Ga0182101_1060967Not Available598Open in IMG/M
3300015290|Ga0182105_1081751Not Available558Open in IMG/M
3300015290|Ga0182105_1089846Not Available539Open in IMG/M
3300015293|Ga0182103_1068426Not Available579Open in IMG/M
3300015297|Ga0182104_1085466Not Available571Open in IMG/M
3300015301|Ga0182184_1069876Not Available573Open in IMG/M
3300015306|Ga0182180_1022067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum851Open in IMG/M
3300015306|Ga0182180_1030627Not Available754Open in IMG/M
3300015309|Ga0182098_1112270Not Available528Open in IMG/M
3300015310|Ga0182162_1057591Not Available677Open in IMG/M
3300015311|Ga0182182_1064824Not Available632Open in IMG/M
3300015311|Ga0182182_1085204Not Available574Open in IMG/M
3300015313|Ga0182164_1066073Not Available665Open in IMG/M
3300015315|Ga0182120_1030871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae868Open in IMG/M
3300015315|Ga0182120_1040135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum796Open in IMG/M
3300015317|Ga0182136_1043784Not Available773Open in IMG/M
3300015317|Ga0182136_1091208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae596Open in IMG/M
3300015317|Ga0182136_1108592Not Available558Open in IMG/M
3300015320|Ga0182165_1009747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1274Open in IMG/M
3300015320|Ga0182165_1077076Not Available649Open in IMG/M
3300015324|Ga0182134_1004573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1510Open in IMG/M
3300015324|Ga0182134_1011793All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1181Open in IMG/M
3300015325|Ga0182148_1031204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum866Open in IMG/M
3300015325|Ga0182148_1055445Not Available719Open in IMG/M
3300015326|Ga0182166_1111781Not Available557Open in IMG/M
3300015327|Ga0182114_1090486All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum639Open in IMG/M
3300015327|Ga0182114_1131314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis550Open in IMG/M
3300015328|Ga0182153_1039053Not Available828Open in IMG/M
3300015328|Ga0182153_1084560Not Available634Open in IMG/M
3300015328|Ga0182153_1116952Not Available560Open in IMG/M
3300015329|Ga0182135_1062062Not Available714Open in IMG/M
3300015332|Ga0182117_1086551Not Available669Open in IMG/M
3300015332|Ga0182117_1096956Not Available639Open in IMG/M
3300015332|Ga0182117_1129687All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum565Open in IMG/M
3300015333|Ga0182147_1047013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum827Open in IMG/M
3300015334|Ga0182132_1086596Not Available664Open in IMG/M
3300015336|Ga0182150_1038663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum868Open in IMG/M
3300015336|Ga0182150_1055818Not Available766Open in IMG/M
3300015336|Ga0182150_1090332Not Available642Open in IMG/M
3300015336|Ga0182150_1094021Not Available633Open in IMG/M
3300015339|Ga0182149_1057593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis780Open in IMG/M
3300015339|Ga0182149_1120084Not Available588Open in IMG/M
3300015348|Ga0182115_1277830Not Available530Open in IMG/M
3300015350|Ga0182163_1006162Not Available2300Open in IMG/M
3300015350|Ga0182163_1050342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1174Open in IMG/M
3300015350|Ga0182163_1194242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae636Open in IMG/M
3300015352|Ga0182169_1063631Not Available1135Open in IMG/M
3300015353|Ga0182179_1126251Not Available784Open in IMG/M
3300015353|Ga0182179_1126589Not Available783Open in IMG/M
3300015353|Ga0182179_1158805Not Available708Open in IMG/M
3300015353|Ga0182179_1192801Not Available647Open in IMG/M
3300015354|Ga0182167_1366531Not Available501Open in IMG/M
3300017408|Ga0182197_1085764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum625Open in IMG/M
3300017412|Ga0182199_1012204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1337Open in IMG/M
3300017421|Ga0182213_1208334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis557Open in IMG/M
3300017421|Ga0182213_1234811Not Available525Open in IMG/M
3300017422|Ga0182201_1011154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1150Open in IMG/M
3300017432|Ga0182196_1041673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae790Open in IMG/M
3300017435|Ga0182194_1102565Not Available587Open in IMG/M
3300017435|Ga0182194_1106801Not Available578Open in IMG/M
3300017445|Ga0182198_1048395Not Available857Open in IMG/M
3300025530|Ga0207866_1047691Not Available542Open in IMG/M
3300025972|Ga0207668_10890696All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum792Open in IMG/M
3300026089|Ga0207648_11552382Not Available622Open in IMG/M
3300028050|Ga0268328_1035880Not Available647Open in IMG/M
3300028054|Ga0268306_1020730Not Available599Open in IMG/M
3300028055|Ga0268338_1002607Not Available1131Open in IMG/M
3300028056|Ga0268330_1005565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1104Open in IMG/M
3300028058|Ga0268332_1042299Not Available635Open in IMG/M
3300028063|Ga0268350_1036397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae714Open in IMG/M
3300028063|Ga0268350_1060392Not Available546Open in IMG/M
3300028064|Ga0268340_1079368Not Available519Open in IMG/M
3300028140|Ga0268334_1005174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum774Open in IMG/M
3300028141|Ga0268326_1013149Not Available518Open in IMG/M
3300028148|Ga0268354_1012390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum695Open in IMG/M
3300028150|Ga0268343_1010453Not Available627Open in IMG/M
3300028251|Ga0268324_1014732Not Available602Open in IMG/M
3300028256|Ga0268304_1000659All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1413Open in IMG/M
3300028381|Ga0268264_10553070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1129Open in IMG/M
3300028467|Ga0268333_1001360All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum991Open in IMG/M
3300028471|Ga0268323_1005801Not Available739Open in IMG/M
3300028477|Ga0268309_1016300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae549Open in IMG/M
3300028526|Ga0268339_1010394Not Available617Open in IMG/M
3300028527|Ga0268335_1000895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1218Open in IMG/M
3300032464|Ga0214492_1085537Not Available596Open in IMG/M
3300032467|Ga0214488_1078756Not Available726Open in IMG/M
3300032502|Ga0214490_1001791All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera2861Open in IMG/M
3300032548|Ga0214483_1003197All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax2035Open in IMG/M
3300032590|Ga0214489_1029375All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae823Open in IMG/M
3300032599|Ga0352977_1013213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae578Open in IMG/M
3300032698|Ga0214485_1004951Not Available1920Open in IMG/M
3300032759|Ga0314720_1034285All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae619Open in IMG/M
3300032760|Ga0314754_1015913Not Available1160Open in IMG/M
3300032781|Ga0314742_1039255Not Available843Open in IMG/M
3300032812|Ga0314745_1111314Not Available563Open in IMG/M
3300032822|Ga0314740_1033018All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis777Open in IMG/M
3300032959|Ga0314738_1002833All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax2221Open in IMG/M
3300032959|Ga0314738_1089710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300033530|Ga0314760_1042093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae1122Open in IMG/M
3300033535|Ga0314759_1240112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum575Open in IMG/M
3300033537|Ga0314766_1294163Not Available585Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere70.45%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere14.39%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.27%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated2.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.52%
Fungi-Associated Bovine RumenHost-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.76%
Ionic Liquid And High Solid EnrichedEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched0.76%
Switchgrass DegradingEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012949Switchgrass enrichment cultures co-assemblyEngineeredOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300025530Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-3-D (SPAdes)EngineeredOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028063Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028140Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028141Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028148Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028150Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028251Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028256Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028467Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028471Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028477Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028526Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028527Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300032464Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032548Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032590Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032599Metatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-1 switchgrass (Eukaryote Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032759Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032760Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032781Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032812Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032822Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032959Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033537Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070668_10117499813300005347Switchgrass RhizosphereGPNSNFKFEFKKMKNSQKIPKNISRCKEFNGVKFFQKIVHLVWFAEFIS*
Ga0070671_10126368713300005355Switchgrass RhizosphereTGSGSVRYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS*
Ga0068864_10036227323300005618Switchgrass RhizosphereGSVRYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS*
Ga0068860_10257904313300005843Switchgrass RhizosphereGPNSKFEFEFKKMKNSQKIPKNISRCKESNGVKFSQKFVHLVWFAEFIS*
Ga0105249_1234618413300009553Switchgrass RhizosphereNSKFKFKFKKMKNSQKIPKNTSRCDKSNGVKFSQKFIHLV*
Ga0105249_1266098913300009553Switchgrass RhizosphereYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS*
Ga0105136_10407323300009973Switchgrass AssociatedFQTGPNLNFKFQLKNKKISKNTSSCDESNGVKFFQIFVHLVYFASI*
Ga0105136_11203913300009973Switchgrass AssociatedFQTGQNSNFKFEFQKIEKSQKILKNNSNCDESNGVKFFQIFVHLVYFAGI*
Ga0105133_13203113300009981Switchgrass AssociatedGRFQTGPNLKFKFEFKKMKKSQKIPKNTSSCDESNGVKFFQIFVHLVYFAGI*
Ga0134125_1181925813300010371Terrestrial SoilKFEFELIKMKNSQKIPKNISRYDESNGVKFSQIFDHLLWFAEFRS*
Ga0134126_1183387713300010396Terrestrial SoilFPKFKFEFKKVKNSQKISKNTSRCDESSGAKFSQKFIHLV*
Ga0134123_1188438013300010403Terrestrial SoilPGSGYDRYETGRNSKFKIEIKKMKKSQKNPKNTSRCDESNGVKFSQKFIRLTYFSGI*
Ga0153798_1026737213300012949Switchgrass DegradingGSVRYETGQNSKFKFEFKKMKNFQKIPKNISRCKESNGVKFSQKFVHLVWFAEFIS*
Ga0157380_1202763413300014326Switchgrass RhizospherePYETGQILKFEFEFIKMKNSQKIRKNISRYNESNGVKFSPKFVHLVWFAEFLS*
Ga0157379_1214739013300014968Switchgrass RhizosphereKTGGNRSDLTPNSKFKFEFKKMKNFQNISKNTSRCDESTGDKFSQKFICLTYFSGI*
Ga0182183_100543723300015270Switchgrass PhyllosphereCELIKMKNSQKIPKNISRYDEFNGVKFSQIFDHLVWFAEFRS*
Ga0182102_102386213300015273Switchgrass PhyllosphereGSNSKFKFEFKKIKFFQKNTSSCDESNGFKFSQKIVRLTYFSGI*
Ga0182102_104181613300015273Switchgrass PhyllosphereTKFKFEFKKNENFPKKIPKNTSSCDESNGIKFFQIFVHLVYFASI*N*
Ga0182100_100457123300015280Switchgrass PhyllosphereEFIKMKNSQKIPKNISKYDESNGVKFSQIFDHLVWFAEFRS*
Ga0182100_101897113300015280Switchgrass PhyllosphereKTGPNLKFKFKFKKIKNSQKNSKNTSKCDESNGVKFSQKFVHLV*
Ga0182100_103099513300015280Switchgrass PhyllosphereGPNSNFKFELKKMKNSQKIPKNTSRYDESNGVKFSQKSIH*
Ga0182100_103618313300015280Switchgrass PhyllosphereLGWYQTGPNSKFKFEFKKIKNSKKIPKNTSSCDEFNGVKFSQKFVHL
Ga0182101_105787013300015284Switchgrass PhyllosphereTGPNSKFKFEFKKMKNSQKIPKNTSRCDESNGVNFSQKFVYLV*
Ga0182101_106096713300015284Switchgrass PhyllosphereRFANRPNLKFKFEFKKNEKFPKKNCKNTSSCDESNGVKVFQIFIHLVYFEGM*
Ga0182105_108175113300015290Switchgrass PhyllosphereEIFKFEFKKLKNERKIPKNTSRCVESNGVKKFQIFVHLVYFTSI*
Ga0182105_108984623300015290Switchgrass PhyllosphereQTGPNLKFKFKKMKKIQKIPKNISRCDESNGVKFSQKFIHLV*
Ga0182103_106842613300015293Switchgrass PhyllosphereVRYETGPNSKFKFEFKKMKNSQKIPKNISRCKEFNGVKFSQKFVHLV*
Ga0182104_108546613300015297Switchgrass PhyllosphereNSKFKFELKKMKNSQKIPKNTSRCNESNDVKFSPKFVHLVWFAEFIS*
Ga0182184_106987613300015301Switchgrass PhyllosphereYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNDVKFSPKFVHLVWFAEFIS*
Ga0182180_102206713300015306Switchgrass PhyllosphereNFKFEFKKNEKFPKIFFKNTSSYDETNGVKFLQIFVHLVYFAGI*
Ga0182180_103062713300015306Switchgrass PhyllosphereETGPNSKFKFKFKKMKNSQKNPKNTSRYNESNGVKFSPKFVHLVWFAEFIS*
Ga0182098_111227013300015309Switchgrass PhyllosphereTGPNLKFKFEFKKMKKSQNIPKNTSSCYESNGVKFFQIFVQLVYFAGI*
Ga0182162_105759113300015310Switchgrass PhyllosphereETGQILKFEFEFIKMKNSQNIPKNISRYDESNGVKFSQIFDHLVWFAEFRS*
Ga0182182_106482413300015311Switchgrass PhyllosphereKFKLKKIKKILQKIPKNISRCDEFNGVKFSQKFVHLV*
Ga0182182_108520413300015311Switchgrass PhyllosphereSGSDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFRS*
Ga0182164_106607313300015313Switchgrass PhyllosphereGPNSKFKFEFKKMKNSQKIPKNTSRCNESNDVKFSPKFVHLVWFAEFIS*
Ga0182120_103087113300015315Switchgrass PhyllosphereQNSKFKFEFKKMKNSQKIPKNISRCKESNGVKFSQKFVHLVWFAEFIS*
Ga0182120_104013513300015315Switchgrass PhyllosphereVRPGSGLVRYETGPNSKFKFELKKMKNSQKIPKNTSRCDESNGVKFSQKFVHLVWFAEFIS*
Ga0182136_104378413300015317Switchgrass PhyllosphereFKFEFKKMKNSQKIPKNTSRCDESNGVKLSQKFAQ*
Ga0182136_109120813300015317Switchgrass PhyllosphereLGWYQTGSNSKFKLKKMKKSQKIPKNTSRCDESNGVKFSQKF
Ga0182136_110859213300015317Switchgrass PhyllosphereQILKFEFEFIKMKNSQNIPKNISRYEESNGVKFSQIFDH*
Ga0182165_100974723300015320Switchgrass PhyllosphereRYETAQILKFEFEFIKMKNSQKIPKNISRYDESNGVKFFQIFDHLVWFAEFRS*
Ga0182165_107707613300015320Switchgrass PhyllosphereSKFKFKFKKNKNSQKIPKNTSNCDESNGVKFSQKFVHLVKFAEF*
Ga0182134_100457313300015324Switchgrass PhyllosphereFEFELIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS*
Ga0182134_101179313300015324Switchgrass PhyllosphereTGSVRYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS*
Ga0182134_106403423300015324Switchgrass PhyllosphereGSGTGRFQTGPNLKFKFEFKKMKKSQKIPKNTSSCDETNGVNFFQIFVHLVYFAGI*
Ga0182148_103120413300015325Switchgrass PhyllosphereETGPNSKFKFEFKKMKNSQKIPKNTSRCDESNGVKFSPKFVHLVWFAEFIS*
Ga0182148_105544513300015325Switchgrass PhyllosphereKFKFKFKKIKNSQKISKNTLRCDESNGVKFSQKFVHLI*
Ga0182166_108298113300015326Switchgrass PhyllospherePPAAGRLVSGLGRYQIGLNSKFKFEFKKIKKFQKNSKNTLRRDESNDFKFSQKFINLV*
Ga0182166_111178113300015326Switchgrass PhyllosphereQKGTEEQENRPNSNFKFKFKKIKISKNTSRCDKSNGVKFSQKFVHLV*
Ga0182114_109048613300015327Switchgrass PhyllosphereGTGSVRYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS*
Ga0182114_109927813300015327Switchgrass PhyllosphereVKLVGTGSGTGRFQTGLNLNSKNKKIPKNSSSCDESNGVNFFQIFVHLLYFASI*
Ga0182114_113131413300015327Switchgrass PhyllosphereQARTGSGIGRLETGPNSNFKFEFQKMEKSQKIPKNTSRCNESNGVKFSQKFVYLI*
Ga0182153_103905323300015328Switchgrass PhyllosphereSKFKFKFKKMKNSQKIPKNTSRCDESNGVKFSQKSVHLV*
Ga0182153_108456013300015328Switchgrass PhyllosphereTGPNSKFKFKFRKMKNSQKFPKNTSSCEESNGVKFFQIFVHLVYFASI*
Ga0182153_111695213300015328Switchgrass PhyllospherePTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFRS*
Ga0182135_106206213300015329Switchgrass PhyllosphereQTGHNSKFKFEFKKMKKSQKIPKNTTRCEESNDVKISQKFVHLA*
Ga0182117_108655113300015332Switchgrass PhyllosphereLETGPNSKFKFELKKRKFSKKNLKNTSRCDESNGVKF
Ga0182117_109695613300015332Switchgrass PhyllosphereLIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS*
Ga0182117_112968713300015332Switchgrass PhyllosphereGTGSVRYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNDVKFSPKFVHLVWFAEFIS*
Ga0182147_104701313300015333Switchgrass PhyllosphereKFKFEFKKMKKSQKIPKNTTRCEESNDVKLSQKFVHLA*
Ga0182132_108659613300015334Switchgrass PhyllosphereETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNDVKFSPKFVHLVWFAEFIS*
Ga0182150_103866313300015336Switchgrass PhyllosphereQTGHNSKFKFEFKKMKKSQKIPKNTTRCEESNDVKLSQKFVHLA*
Ga0182150_105581813300015336Switchgrass PhyllosphereGSYSKFKFKFKKIKILKKIPKNTSRCDESNGVKFPQKFVHLV*
Ga0182150_109033213300015336Switchgrass PhyllosphereLGRYQTGPNSKFKFEFEKMKNFQKIYKNTSRCEEYNGVKFSQKFIHLTYFSGI
Ga0182150_109402113300015336Switchgrass PhyllosphereFEFKKMKNSQKNPKNISRCKESNGVKFSPKFVYLVWFAEFIS*
Ga0182149_105759323300015339Switchgrass PhyllospherePTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFIS*
Ga0182149_109054613300015339Switchgrass PhyllosphereLTYPKFKIQIWIKKMKKIQKIPKNTSRCDESNGVKFSQKIVHL
Ga0182149_112008413300015339Switchgrass PhyllosphereKFKFEFKKMKNSQKIPKNTLRCDESNGVKFSQKFVHLVWFA*
Ga0182115_127783013300015348Switchgrass PhyllosphereILKFEFEFIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS*
Ga0182163_100616213300015350Switchgrass PhyllosphereTGSNSKFKFEFKKMKKFQKNPKNTSRCDESNSVKFSQKFVHLV*
Ga0182163_105034233300015350Switchgrass PhyllosphereGSDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFRS*
Ga0182163_107756913300015350Switchgrass PhyllosphereRSGLTGPGSGSDRYETGQNSKFKFEIKKMKNSQKIPKNTSRCDESNGVKLSQKFAQ*
Ga0182163_119424223300015350Switchgrass PhyllosphereRPGFDLGRYQTKLNSKFKFKFKKMKNSQNNPKNILRCDKSNDVKFSQKFVHLI*
Ga0182169_106363113300015352Switchgrass PhyllosphereLSWYQTGPNLKFKFEFKKMKNSQKIHKNTSRCDEYNGVKFSQKFIRLTYFSGI
Ga0182179_112625123300015353Switchgrass PhyllosphereFKFEFKKMKKSQKIPKNITRCEESNDVKLSQKFVHLA*
Ga0182179_112658913300015353Switchgrass PhyllosphereKNQIQNLNLNFKNEKFPKNTSSYDESNGVKFFQIFVHLVYFAGI*
Ga0182179_115880513300015353Switchgrass PhyllosphereSSNLKFKFELKKIPKNTSSCDESNGVKFFQIFIHLVYFAGI*
Ga0182179_119280113300015353Switchgrass PhyllosphereGSGSGRLETGPNSNFKFEFEKMEKIQKILKNTSSCDESNGVNFFQIFIHLIYFASI*
Ga0182167_136653113300015354Switchgrass PhyllosphereTGPNSNFKFEFQKMEKSQKILKNTSSCDESNDVKNFQKFVHLVYFASI*
Ga0182197_108576423300017408Switchgrass PhyllosphereSGLGRFQIGPNLKFKFEFKKMKNSQKDAKNTSNCDESNDVKFFQIFVHLVYFASI
Ga0182199_101220423300017412Switchgrass PhyllosphereFEFKKMKNSQKIPKNISRCKESNGVKFSPKFVYLVWFAEFIS
Ga0182213_113965113300017421Switchgrass PhyllosphereKFEFKKMKIPKKIPKNTSRCDESNGVKFSQKSVHLE
Ga0182213_120833413300017421Switchgrass PhyllosphereFEFEFKKMKNSQKIPKNISRCKESNGVKFSQKFVNLVWFAEFIS
Ga0182213_123481123300017421Switchgrass PhyllosphereVRYETGPNSKFKFEFKKMKNSQKIPKNISRCKESNGVKFSQKIVHLVWFAEFIS
Ga0182201_101115413300017422Switchgrass PhyllosphereQTGHNSKFKFEFKKMKKSLKIPKNTTRCEESNDVKISQKFVHLA
Ga0182196_104167313300017432Switchgrass PhyllosphereTGPNSKFKFKFKKMKNSQKIPKNTSMCDESNGVKFSQKFVHLV
Ga0182194_110256513300017435Switchgrass PhyllospherePVANWPNSKFKFELKKMKNSQKIPKNTSSCDKSNGVKFFQIFVHLVYFASM
Ga0182194_110680113300017435Switchgrass PhyllosphereLVRFETGQILKFEFELIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS
Ga0182198_104839513300017445Switchgrass PhyllosphereKFKFEFKKIKKIQKNSKYTSRCDEFNSVKFSQKFVHLVWFAEFRS
Ga0207866_104769113300025530Ionic Liquid And High Solid EnrichedWYQTGRNSNFKFKFKKMKNSQKIPKNTSRCDESNGVKFSQKFVHLV
Ga0207668_1089069613300025972Switchgrass RhizospherePNSKFKFELKKRKIPKNTSRCDESNGVKFSQKFVHLA
Ga0207648_1155238223300026089Miscanthus RhizospherePNSKFKFELKKMKNSQKIPKNTSRCDKFNGVKFSQKFVHLV
Ga0268328_103588013300028050PhyllosphereKFEFKKMKKSQKIPKNTTRCEESNDVKLSQKFVHLA
Ga0268306_102073013300028054PhyllosphereTGPNLKFKFKFKKMKNFQKNSKNTSRCDESNGVKFSQKFVYLL
Ga0268338_100260713300028055PhyllosphereLVRFETGQILKFEFELIKMKNSQKISKNISRYDESNGVKFSQIFDHLVWFAEFRS
Ga0268330_100556523300028056PhyllosphereGSDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFRS
Ga0268332_104229913300028058PhyllosphereGRYQTGSNSKFKFEFKKMKNLQKIPKNTSRCDESNGVKFSQKFIHLV
Ga0268350_103639713300028063PhyllosphereATRVKKTGPNSNFKFEFQNMEKSQKILKNTSSCDESNGVKFFQIFVHLVYFASI
Ga0268350_106039213300028063PhyllosphereINDNRMRLTCVGNFETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS
Ga0268340_107936813300028064PhyllosphereFELIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS
Ga0268334_100517423300028140PhyllosphereEFKKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS
Ga0268326_101314923300028141PhyllosphereETGQILKFEFEFIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS
Ga0268354_101239023300028148PhyllosphereGLGRYQTGLNSKFKFEFKKMKNSQKNPKNTSRCDKFNGVKFSQKFIRLTYFSAI
Ga0268343_101045313300028150PhyllosphereHNSKFKFEFKKMKKSQKIPKNTTRCEESNDVKLSQKFVHLA
Ga0268324_101473213300028251PhyllosphereMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS
Ga0268304_100065923300028256PhyllosphereRYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS
Ga0268264_1055307013300028381Switchgrass RhizosphereVRYETGQILKFEYEFIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS
Ga0268333_100136023300028467PhyllosphereYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS
Ga0268323_100580113300028471PhyllosphereSGSDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFRS
Ga0268309_101630023300028477PhyllosphereETGPNSKFEFEFKKMKNSQKIPKNISRCKESNGVKFSQKFVHLVWFAEFIS
Ga0268339_101039413300028526PhyllosphereQILKFEFEFIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS
Ga0268335_100089523300028527PhyllospherePNSKFKFEFKKMKKFQKIPKNTSRCDESNGVKFSQKFIRLTYFSGI
Ga0214492_108553713300032464Switchgrass PhyllosphereGPNLKFKFEFKKNKKIPKKIPNNTSSCDEFNDVKFFQIFVHLVYFASI
Ga0214493_105964013300032465Switchgrass PhyllosphereKMKNSQKIPKNISRYDESNGVKFSQIFDHLLWFAEFRS
Ga0214488_107875613300032467Switchgrass PhyllospherePNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFLS
Ga0214490_100179113300032502Switchgrass PhyllosphereETGQNSKFKFKFKKMKNSQKLPKNISRCKESNGVKFSQKFVHLVWFAEFIS
Ga0214483_100319713300032548Switchgrass PhyllosphereLVRFETGQILKFEFELIKMKNSQKIPKNISRYDESNGVKFSQIFDHLLWFA
Ga0214489_102937513300032590Switchgrass PhyllospherePNSNFKFEFQNMEKSQKILKNTSSCDESNGVKFFQIFVHLVYFASI
Ga0352977_101321323300032599Fungi-Associated Bovine RumenRTGSGSDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFIS
Ga0214485_100495113300032698Switchgrass PhyllosphereSGSGRLETGPNSNFKFEFEKMEKSQKIFKNTSSCDESNDVKFFQIFINLVYFASI
Ga0314720_103428513300032759Switchgrass PhyllospherePNSKFKFEFKKMKNSQKNPKNISRCKESNDVKFSQKFVHLVWFVEFIS
Ga0314754_101591323300032760Switchgrass PhyllosphereSDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNDIKFSQKFVHLVWFAEFIS
Ga0314742_103925513300032781Switchgrass PhyllosphereGPNSKFKFKFQKMKNSQKIPKNTSSCDESNGVKNFQIFVHLVYFAGI
Ga0314745_111131413300032812Switchgrass PhyllosphereVAPRVYKTGSGPNSKFKFEFKKNEKFPKKIPKNTLSCDESNGVKFSQKFVRLTYFSGI
Ga0314740_103301813300032822Switchgrass PhyllosphereNSNFKFEFKKMKNSQKIPKNISRCKESNGVKFSQKIVHLVWFAEFIS
Ga0314738_100283313300032959Switchgrass PhyllosphereLVRFETGQILKFEFELIKMKNSQKIPKNILRYDESNGVKFSQIFDHLLWFAEFR
Ga0314738_108971013300032959Switchgrass PhyllosphereSGLGRYQIGPNSKFKFEFKKMKNSQKIPKNTSRCDESNSVKFSQKFIHLVYFAGI
Ga0314761_109218313300033526Switchgrass PhyllosphereKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS
Ga0314760_104209323300033530Switchgrass PhyllosphereGSGIGRLETGPNSNFKFEFQKMEKSQKIPQNTLRCDESNGVKFSQKFVHLV
Ga0314759_124011213300033535Switchgrass PhyllospherePIQNLKFEFKKIKNSQKFPKNTSSCDESNGVKFFQIFVHLVYFAGI
Ga0314766_129416323300033537Switchgrass PhyllospherePVHTGLNSKFKFEFKKMENSQKIPKNTSRCDESNGVKFSQKFIHLV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.