| Basic Information | |
|---|---|
| Family ID | F060529 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 48 residues |
| Representative Sequence | ETGPNSKFKFEFKKMKNSQKIPKNTSRCDESNGVKFSPKFVHLVWFAEFIS |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.23 % |
| % of genes near scaffold ends (potentially truncated) | 92.42 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.121 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (70.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.394 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (73.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.71% β-sheet: 0.00% Coil/Unstructured: 63.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF02892 | zf-BED | 3.79 |
| PF00069 | Pkinase | 1.52 |
| PF00078 | RVT_1 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.06 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.12 % |
| All Organisms | root | All Organisms | 37.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005347|Ga0070668_101174998 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 694 | Open in IMG/M |
| 3300005355|Ga0070671_101263687 | Not Available | 651 | Open in IMG/M |
| 3300005618|Ga0068864_100362273 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1370 | Open in IMG/M |
| 3300005843|Ga0068860_102579043 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 527 | Open in IMG/M |
| 3300009553|Ga0105249_12346184 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 606 | Open in IMG/M |
| 3300009553|Ga0105249_12660989 | Not Available | 572 | Open in IMG/M |
| 3300009973|Ga0105136_104073 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 779 | Open in IMG/M |
| 3300009973|Ga0105136_112039 | Not Available | 536 | Open in IMG/M |
| 3300009981|Ga0105133_132031 | Not Available | 503 | Open in IMG/M |
| 3300010371|Ga0134125_11819258 | Not Available | 662 | Open in IMG/M |
| 3300010396|Ga0134126_11833877 | Not Available | 664 | Open in IMG/M |
| 3300010403|Ga0134123_11884380 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 653 | Open in IMG/M |
| 3300012949|Ga0153798_10267372 | Not Available | 566 | Open in IMG/M |
| 3300014326|Ga0157380_12027634 | Not Available | 637 | Open in IMG/M |
| 3300014968|Ga0157379_12147390 | Not Available | 554 | Open in IMG/M |
| 3300015270|Ga0182183_1005437 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1128 | Open in IMG/M |
| 3300015273|Ga0182102_1023862 | Not Available | 606 | Open in IMG/M |
| 3300015273|Ga0182102_1041816 | Not Available | 521 | Open in IMG/M |
| 3300015280|Ga0182100_1004571 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1276 | Open in IMG/M |
| 3300015280|Ga0182100_1018971 | Not Available | 860 | Open in IMG/M |
| 3300015280|Ga0182100_1030995 | Not Available | 742 | Open in IMG/M |
| 3300015280|Ga0182100_1036183 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 708 | Open in IMG/M |
| 3300015284|Ga0182101_1057870 | Not Available | 608 | Open in IMG/M |
| 3300015284|Ga0182101_1060967 | Not Available | 598 | Open in IMG/M |
| 3300015290|Ga0182105_1081751 | Not Available | 558 | Open in IMG/M |
| 3300015290|Ga0182105_1089846 | Not Available | 539 | Open in IMG/M |
| 3300015293|Ga0182103_1068426 | Not Available | 579 | Open in IMG/M |
| 3300015297|Ga0182104_1085466 | Not Available | 571 | Open in IMG/M |
| 3300015301|Ga0182184_1069876 | Not Available | 573 | Open in IMG/M |
| 3300015306|Ga0182180_1022067 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 851 | Open in IMG/M |
| 3300015306|Ga0182180_1030627 | Not Available | 754 | Open in IMG/M |
| 3300015309|Ga0182098_1112270 | Not Available | 528 | Open in IMG/M |
| 3300015310|Ga0182162_1057591 | Not Available | 677 | Open in IMG/M |
| 3300015311|Ga0182182_1064824 | Not Available | 632 | Open in IMG/M |
| 3300015311|Ga0182182_1085204 | Not Available | 574 | Open in IMG/M |
| 3300015313|Ga0182164_1066073 | Not Available | 665 | Open in IMG/M |
| 3300015315|Ga0182120_1030871 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 868 | Open in IMG/M |
| 3300015315|Ga0182120_1040135 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 796 | Open in IMG/M |
| 3300015317|Ga0182136_1043784 | Not Available | 773 | Open in IMG/M |
| 3300015317|Ga0182136_1091208 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 596 | Open in IMG/M |
| 3300015317|Ga0182136_1108592 | Not Available | 558 | Open in IMG/M |
| 3300015320|Ga0182165_1009747 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1274 | Open in IMG/M |
| 3300015320|Ga0182165_1077076 | Not Available | 649 | Open in IMG/M |
| 3300015324|Ga0182134_1004573 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1510 | Open in IMG/M |
| 3300015324|Ga0182134_1011793 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1181 | Open in IMG/M |
| 3300015325|Ga0182148_1031204 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 866 | Open in IMG/M |
| 3300015325|Ga0182148_1055445 | Not Available | 719 | Open in IMG/M |
| 3300015326|Ga0182166_1111781 | Not Available | 557 | Open in IMG/M |
| 3300015327|Ga0182114_1090486 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 639 | Open in IMG/M |
| 3300015327|Ga0182114_1131314 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 550 | Open in IMG/M |
| 3300015328|Ga0182153_1039053 | Not Available | 828 | Open in IMG/M |
| 3300015328|Ga0182153_1084560 | Not Available | 634 | Open in IMG/M |
| 3300015328|Ga0182153_1116952 | Not Available | 560 | Open in IMG/M |
| 3300015329|Ga0182135_1062062 | Not Available | 714 | Open in IMG/M |
| 3300015332|Ga0182117_1086551 | Not Available | 669 | Open in IMG/M |
| 3300015332|Ga0182117_1096956 | Not Available | 639 | Open in IMG/M |
| 3300015332|Ga0182117_1129687 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 565 | Open in IMG/M |
| 3300015333|Ga0182147_1047013 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 827 | Open in IMG/M |
| 3300015334|Ga0182132_1086596 | Not Available | 664 | Open in IMG/M |
| 3300015336|Ga0182150_1038663 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 868 | Open in IMG/M |
| 3300015336|Ga0182150_1055818 | Not Available | 766 | Open in IMG/M |
| 3300015336|Ga0182150_1090332 | Not Available | 642 | Open in IMG/M |
| 3300015336|Ga0182150_1094021 | Not Available | 633 | Open in IMG/M |
| 3300015339|Ga0182149_1057593 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 780 | Open in IMG/M |
| 3300015339|Ga0182149_1120084 | Not Available | 588 | Open in IMG/M |
| 3300015348|Ga0182115_1277830 | Not Available | 530 | Open in IMG/M |
| 3300015350|Ga0182163_1006162 | Not Available | 2300 | Open in IMG/M |
| 3300015350|Ga0182163_1050342 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1174 | Open in IMG/M |
| 3300015350|Ga0182163_1194242 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 636 | Open in IMG/M |
| 3300015352|Ga0182169_1063631 | Not Available | 1135 | Open in IMG/M |
| 3300015353|Ga0182179_1126251 | Not Available | 784 | Open in IMG/M |
| 3300015353|Ga0182179_1126589 | Not Available | 783 | Open in IMG/M |
| 3300015353|Ga0182179_1158805 | Not Available | 708 | Open in IMG/M |
| 3300015353|Ga0182179_1192801 | Not Available | 647 | Open in IMG/M |
| 3300015354|Ga0182167_1366531 | Not Available | 501 | Open in IMG/M |
| 3300017408|Ga0182197_1085764 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 625 | Open in IMG/M |
| 3300017412|Ga0182199_1012204 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1337 | Open in IMG/M |
| 3300017421|Ga0182213_1208334 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 557 | Open in IMG/M |
| 3300017421|Ga0182213_1234811 | Not Available | 525 | Open in IMG/M |
| 3300017422|Ga0182201_1011154 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1150 | Open in IMG/M |
| 3300017432|Ga0182196_1041673 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 790 | Open in IMG/M |
| 3300017435|Ga0182194_1102565 | Not Available | 587 | Open in IMG/M |
| 3300017435|Ga0182194_1106801 | Not Available | 578 | Open in IMG/M |
| 3300017445|Ga0182198_1048395 | Not Available | 857 | Open in IMG/M |
| 3300025530|Ga0207866_1047691 | Not Available | 542 | Open in IMG/M |
| 3300025972|Ga0207668_10890696 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 792 | Open in IMG/M |
| 3300026089|Ga0207648_11552382 | Not Available | 622 | Open in IMG/M |
| 3300028050|Ga0268328_1035880 | Not Available | 647 | Open in IMG/M |
| 3300028054|Ga0268306_1020730 | Not Available | 599 | Open in IMG/M |
| 3300028055|Ga0268338_1002607 | Not Available | 1131 | Open in IMG/M |
| 3300028056|Ga0268330_1005565 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1104 | Open in IMG/M |
| 3300028058|Ga0268332_1042299 | Not Available | 635 | Open in IMG/M |
| 3300028063|Ga0268350_1036397 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 714 | Open in IMG/M |
| 3300028063|Ga0268350_1060392 | Not Available | 546 | Open in IMG/M |
| 3300028064|Ga0268340_1079368 | Not Available | 519 | Open in IMG/M |
| 3300028140|Ga0268334_1005174 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 774 | Open in IMG/M |
| 3300028141|Ga0268326_1013149 | Not Available | 518 | Open in IMG/M |
| 3300028148|Ga0268354_1012390 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 695 | Open in IMG/M |
| 3300028150|Ga0268343_1010453 | Not Available | 627 | Open in IMG/M |
| 3300028251|Ga0268324_1014732 | Not Available | 602 | Open in IMG/M |
| 3300028256|Ga0268304_1000659 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1413 | Open in IMG/M |
| 3300028381|Ga0268264_10553070 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1129 | Open in IMG/M |
| 3300028467|Ga0268333_1001360 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 991 | Open in IMG/M |
| 3300028471|Ga0268323_1005801 | Not Available | 739 | Open in IMG/M |
| 3300028477|Ga0268309_1016300 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 549 | Open in IMG/M |
| 3300028526|Ga0268339_1010394 | Not Available | 617 | Open in IMG/M |
| 3300028527|Ga0268335_1000895 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1218 | Open in IMG/M |
| 3300032464|Ga0214492_1085537 | Not Available | 596 | Open in IMG/M |
| 3300032467|Ga0214488_1078756 | Not Available | 726 | Open in IMG/M |
| 3300032502|Ga0214490_1001791 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera | 2861 | Open in IMG/M |
| 3300032548|Ga0214483_1003197 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 2035 | Open in IMG/M |
| 3300032590|Ga0214489_1029375 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 823 | Open in IMG/M |
| 3300032599|Ga0352977_1013213 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 578 | Open in IMG/M |
| 3300032698|Ga0214485_1004951 | Not Available | 1920 | Open in IMG/M |
| 3300032759|Ga0314720_1034285 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 619 | Open in IMG/M |
| 3300032760|Ga0314754_1015913 | Not Available | 1160 | Open in IMG/M |
| 3300032781|Ga0314742_1039255 | Not Available | 843 | Open in IMG/M |
| 3300032812|Ga0314745_1111314 | Not Available | 563 | Open in IMG/M |
| 3300032822|Ga0314740_1033018 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 777 | Open in IMG/M |
| 3300032959|Ga0314738_1002833 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 2221 | Open in IMG/M |
| 3300032959|Ga0314738_1089710 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 539 | Open in IMG/M |
| 3300033530|Ga0314760_1042093 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1122 | Open in IMG/M |
| 3300033535|Ga0314759_1240112 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 575 | Open in IMG/M |
| 3300033537|Ga0314766_1294163 | Not Available | 585 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 70.45% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 14.39% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Fungi-Associated Bovine Rumen | Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 0.76% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012949 | Switchgrass enrichment cultures co-assembly | Engineered | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025530 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-3-D (SPAdes) | Engineered | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028063 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028148 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032548 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032599 | Metatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-1 switchgrass (Eukaryote Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032759 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032760 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032781 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032822 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033537 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070668_1011749981 | 3300005347 | Switchgrass Rhizosphere | GPNSNFKFEFKKMKNSQKIPKNISRCKEFNGVKFFQKIVHLVWFAEFIS* |
| Ga0070671_1012636871 | 3300005355 | Switchgrass Rhizosphere | TGSGSVRYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS* |
| Ga0068864_1003622732 | 3300005618 | Switchgrass Rhizosphere | GSVRYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS* |
| Ga0068860_1025790431 | 3300005843 | Switchgrass Rhizosphere | GPNSKFEFEFKKMKNSQKIPKNISRCKESNGVKFSQKFVHLVWFAEFIS* |
| Ga0105249_123461841 | 3300009553 | Switchgrass Rhizosphere | NSKFKFKFKKMKNSQKIPKNTSRCDKSNGVKFSQKFIHLV* |
| Ga0105249_126609891 | 3300009553 | Switchgrass Rhizosphere | YETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS* |
| Ga0105136_1040732 | 3300009973 | Switchgrass Associated | FQTGPNLNFKFQLKNKKISKNTSSCDESNGVKFFQIFVHLVYFASI* |
| Ga0105136_1120391 | 3300009973 | Switchgrass Associated | FQTGQNSNFKFEFQKIEKSQKILKNNSNCDESNGVKFFQIFVHLVYFAGI* |
| Ga0105133_1320311 | 3300009981 | Switchgrass Associated | GRFQTGPNLKFKFEFKKMKKSQKIPKNTSSCDESNGVKFFQIFVHLVYFAGI* |
| Ga0134125_118192581 | 3300010371 | Terrestrial Soil | KFEFELIKMKNSQKIPKNISRYDESNGVKFSQIFDHLLWFAEFRS* |
| Ga0134126_118338771 | 3300010396 | Terrestrial Soil | FPKFKFEFKKVKNSQKISKNTSRCDESSGAKFSQKFIHLV* |
| Ga0134123_118843801 | 3300010403 | Terrestrial Soil | PGSGYDRYETGRNSKFKIEIKKMKKSQKNPKNTSRCDESNGVKFSQKFIRLTYFSGI* |
| Ga0153798_102673721 | 3300012949 | Switchgrass Degrading | GSVRYETGQNSKFKFEFKKMKNFQKIPKNISRCKESNGVKFSQKFVHLVWFAEFIS* |
| Ga0157380_120276341 | 3300014326 | Switchgrass Rhizosphere | PYETGQILKFEFEFIKMKNSQKIRKNISRYNESNGVKFSPKFVHLVWFAEFLS* |
| Ga0157379_121473901 | 3300014968 | Switchgrass Rhizosphere | KTGGNRSDLTPNSKFKFEFKKMKNFQNISKNTSRCDESTGDKFSQKFICLTYFSGI* |
| Ga0182183_10054372 | 3300015270 | Switchgrass Phyllosphere | CELIKMKNSQKIPKNISRYDEFNGVKFSQIFDHLVWFAEFRS* |
| Ga0182102_10238621 | 3300015273 | Switchgrass Phyllosphere | GSNSKFKFEFKKIKFFQKNTSSCDESNGFKFSQKIVRLTYFSGI* |
| Ga0182102_10418161 | 3300015273 | Switchgrass Phyllosphere | TKFKFEFKKNENFPKKIPKNTSSCDESNGIKFFQIFVHLVYFASI*N* |
| Ga0182100_10045712 | 3300015280 | Switchgrass Phyllosphere | EFIKMKNSQKIPKNISKYDESNGVKFSQIFDHLVWFAEFRS* |
| Ga0182100_10189711 | 3300015280 | Switchgrass Phyllosphere | KTGPNLKFKFKFKKIKNSQKNSKNTSKCDESNGVKFSQKFVHLV* |
| Ga0182100_10309951 | 3300015280 | Switchgrass Phyllosphere | GPNSNFKFELKKMKNSQKIPKNTSRYDESNGVKFSQKSIH* |
| Ga0182100_10361831 | 3300015280 | Switchgrass Phyllosphere | LGWYQTGPNSKFKFEFKKIKNSKKIPKNTSSCDEFNGVKFSQKFVHL |
| Ga0182101_10578701 | 3300015284 | Switchgrass Phyllosphere | TGPNSKFKFEFKKMKNSQKIPKNTSRCDESNGVNFSQKFVYLV* |
| Ga0182101_10609671 | 3300015284 | Switchgrass Phyllosphere | RFANRPNLKFKFEFKKNEKFPKKNCKNTSSCDESNGVKVFQIFIHLVYFEGM* |
| Ga0182105_10817511 | 3300015290 | Switchgrass Phyllosphere | EIFKFEFKKLKNERKIPKNTSRCVESNGVKKFQIFVHLVYFTSI* |
| Ga0182105_10898462 | 3300015290 | Switchgrass Phyllosphere | QTGPNLKFKFKKMKKIQKIPKNISRCDESNGVKFSQKFIHLV* |
| Ga0182103_10684261 | 3300015293 | Switchgrass Phyllosphere | VRYETGPNSKFKFEFKKMKNSQKIPKNISRCKEFNGVKFSQKFVHLV* |
| Ga0182104_10854661 | 3300015297 | Switchgrass Phyllosphere | NSKFKFELKKMKNSQKIPKNTSRCNESNDVKFSPKFVHLVWFAEFIS* |
| Ga0182184_10698761 | 3300015301 | Switchgrass Phyllosphere | YETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNDVKFSPKFVHLVWFAEFIS* |
| Ga0182180_10220671 | 3300015306 | Switchgrass Phyllosphere | NFKFEFKKNEKFPKIFFKNTSSYDETNGVKFLQIFVHLVYFAGI* |
| Ga0182180_10306271 | 3300015306 | Switchgrass Phyllosphere | ETGPNSKFKFKFKKMKNSQKNPKNTSRYNESNGVKFSPKFVHLVWFAEFIS* |
| Ga0182098_11122701 | 3300015309 | Switchgrass Phyllosphere | TGPNLKFKFEFKKMKKSQNIPKNTSSCYESNGVKFFQIFVQLVYFAGI* |
| Ga0182162_10575911 | 3300015310 | Switchgrass Phyllosphere | ETGQILKFEFEFIKMKNSQNIPKNISRYDESNGVKFSQIFDHLVWFAEFRS* |
| Ga0182182_10648241 | 3300015311 | Switchgrass Phyllosphere | KFKLKKIKKILQKIPKNISRCDEFNGVKFSQKFVHLV* |
| Ga0182182_10852041 | 3300015311 | Switchgrass Phyllosphere | SGSDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFRS* |
| Ga0182164_10660731 | 3300015313 | Switchgrass Phyllosphere | GPNSKFKFEFKKMKNSQKIPKNTSRCNESNDVKFSPKFVHLVWFAEFIS* |
| Ga0182120_10308711 | 3300015315 | Switchgrass Phyllosphere | QNSKFKFEFKKMKNSQKIPKNISRCKESNGVKFSQKFVHLVWFAEFIS* |
| Ga0182120_10401351 | 3300015315 | Switchgrass Phyllosphere | VRPGSGLVRYETGPNSKFKFELKKMKNSQKIPKNTSRCDESNGVKFSQKFVHLVWFAEFIS* |
| Ga0182136_10437841 | 3300015317 | Switchgrass Phyllosphere | FKFEFKKMKNSQKIPKNTSRCDESNGVKLSQKFAQ* |
| Ga0182136_10912081 | 3300015317 | Switchgrass Phyllosphere | LGWYQTGSNSKFKLKKMKKSQKIPKNTSRCDESNGVKFSQKF |
| Ga0182136_11085921 | 3300015317 | Switchgrass Phyllosphere | QILKFEFEFIKMKNSQNIPKNISRYEESNGVKFSQIFDH* |
| Ga0182165_10097472 | 3300015320 | Switchgrass Phyllosphere | RYETAQILKFEFEFIKMKNSQKIPKNISRYDESNGVKFFQIFDHLVWFAEFRS* |
| Ga0182165_10770761 | 3300015320 | Switchgrass Phyllosphere | SKFKFKFKKNKNSQKIPKNTSNCDESNGVKFSQKFVHLVKFAEF* |
| Ga0182134_10045731 | 3300015324 | Switchgrass Phyllosphere | FEFELIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS* |
| Ga0182134_10117931 | 3300015324 | Switchgrass Phyllosphere | TGSVRYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS* |
| Ga0182134_10640342 | 3300015324 | Switchgrass Phyllosphere | GSGTGRFQTGPNLKFKFEFKKMKKSQKIPKNTSSCDETNGVNFFQIFVHLVYFAGI* |
| Ga0182148_10312041 | 3300015325 | Switchgrass Phyllosphere | ETGPNSKFKFEFKKMKNSQKIPKNTSRCDESNGVKFSPKFVHLVWFAEFIS* |
| Ga0182148_10554451 | 3300015325 | Switchgrass Phyllosphere | KFKFKFKKIKNSQKISKNTLRCDESNGVKFSQKFVHLI* |
| Ga0182166_10829811 | 3300015326 | Switchgrass Phyllosphere | PPAAGRLVSGLGRYQIGLNSKFKFEFKKIKKFQKNSKNTLRRDESNDFKFSQKFINLV* |
| Ga0182166_11117811 | 3300015326 | Switchgrass Phyllosphere | QKGTEEQENRPNSNFKFKFKKIKISKNTSRCDKSNGVKFSQKFVHLV* |
| Ga0182114_10904861 | 3300015327 | Switchgrass Phyllosphere | GTGSVRYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS* |
| Ga0182114_10992781 | 3300015327 | Switchgrass Phyllosphere | VKLVGTGSGTGRFQTGLNLNSKNKKIPKNSSSCDESNGVNFFQIFVHLLYFASI* |
| Ga0182114_11313141 | 3300015327 | Switchgrass Phyllosphere | QARTGSGIGRLETGPNSNFKFEFQKMEKSQKIPKNTSRCNESNGVKFSQKFVYLI* |
| Ga0182153_10390532 | 3300015328 | Switchgrass Phyllosphere | SKFKFKFKKMKNSQKIPKNTSRCDESNGVKFSQKSVHLV* |
| Ga0182153_10845601 | 3300015328 | Switchgrass Phyllosphere | TGPNSKFKFKFRKMKNSQKFPKNTSSCEESNGVKFFQIFVHLVYFASI* |
| Ga0182153_11169521 | 3300015328 | Switchgrass Phyllosphere | PTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFRS* |
| Ga0182135_10620621 | 3300015329 | Switchgrass Phyllosphere | QTGHNSKFKFEFKKMKKSQKIPKNTTRCEESNDVKISQKFVHLA* |
| Ga0182117_10865511 | 3300015332 | Switchgrass Phyllosphere | LETGPNSKFKFELKKRKFSKKNLKNTSRCDESNGVKF |
| Ga0182117_10969561 | 3300015332 | Switchgrass Phyllosphere | LIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS* |
| Ga0182117_11296871 | 3300015332 | Switchgrass Phyllosphere | GTGSVRYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNDVKFSPKFVHLVWFAEFIS* |
| Ga0182147_10470131 | 3300015333 | Switchgrass Phyllosphere | KFKFEFKKMKKSQKIPKNTTRCEESNDVKLSQKFVHLA* |
| Ga0182132_10865961 | 3300015334 | Switchgrass Phyllosphere | ETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNDVKFSPKFVHLVWFAEFIS* |
| Ga0182150_10386631 | 3300015336 | Switchgrass Phyllosphere | QTGHNSKFKFEFKKMKKSQKIPKNTTRCEESNDVKLSQKFVHLA* |
| Ga0182150_10558181 | 3300015336 | Switchgrass Phyllosphere | GSYSKFKFKFKKIKILKKIPKNTSRCDESNGVKFPQKFVHLV* |
| Ga0182150_10903321 | 3300015336 | Switchgrass Phyllosphere | LGRYQTGPNSKFKFEFEKMKNFQKIYKNTSRCEEYNGVKFSQKFIHLTYFSGI |
| Ga0182150_10940211 | 3300015336 | Switchgrass Phyllosphere | FEFKKMKNSQKNPKNISRCKESNGVKFSPKFVYLVWFAEFIS* |
| Ga0182149_10575932 | 3300015339 | Switchgrass Phyllosphere | PTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFIS* |
| Ga0182149_10905461 | 3300015339 | Switchgrass Phyllosphere | LTYPKFKIQIWIKKMKKIQKIPKNTSRCDESNGVKFSQKIVHL |
| Ga0182149_11200841 | 3300015339 | Switchgrass Phyllosphere | KFKFEFKKMKNSQKIPKNTLRCDESNGVKFSQKFVHLVWFA* |
| Ga0182115_12778301 | 3300015348 | Switchgrass Phyllosphere | ILKFEFEFIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS* |
| Ga0182163_10061621 | 3300015350 | Switchgrass Phyllosphere | TGSNSKFKFEFKKMKKFQKNPKNTSRCDESNSVKFSQKFVHLV* |
| Ga0182163_10503423 | 3300015350 | Switchgrass Phyllosphere | GSDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFRS* |
| Ga0182163_10775691 | 3300015350 | Switchgrass Phyllosphere | RSGLTGPGSGSDRYETGQNSKFKFEIKKMKNSQKIPKNTSRCDESNGVKLSQKFAQ* |
| Ga0182163_11942422 | 3300015350 | Switchgrass Phyllosphere | RPGFDLGRYQTKLNSKFKFKFKKMKNSQNNPKNILRCDKSNDVKFSQKFVHLI* |
| Ga0182169_10636311 | 3300015352 | Switchgrass Phyllosphere | LSWYQTGPNLKFKFEFKKMKNSQKIHKNTSRCDEYNGVKFSQKFIRLTYFSGI |
| Ga0182179_11262512 | 3300015353 | Switchgrass Phyllosphere | FKFEFKKMKKSQKIPKNITRCEESNDVKLSQKFVHLA* |
| Ga0182179_11265891 | 3300015353 | Switchgrass Phyllosphere | KNQIQNLNLNFKNEKFPKNTSSYDESNGVKFFQIFVHLVYFAGI* |
| Ga0182179_11588051 | 3300015353 | Switchgrass Phyllosphere | SSNLKFKFELKKIPKNTSSCDESNGVKFFQIFIHLVYFAGI* |
| Ga0182179_11928011 | 3300015353 | Switchgrass Phyllosphere | GSGSGRLETGPNSNFKFEFEKMEKIQKILKNTSSCDESNGVNFFQIFIHLIYFASI* |
| Ga0182167_13665311 | 3300015354 | Switchgrass Phyllosphere | TGPNSNFKFEFQKMEKSQKILKNTSSCDESNDVKNFQKFVHLVYFASI* |
| Ga0182197_10857642 | 3300017408 | Switchgrass Phyllosphere | SGLGRFQIGPNLKFKFEFKKMKNSQKDAKNTSNCDESNDVKFFQIFVHLVYFASI |
| Ga0182199_10122042 | 3300017412 | Switchgrass Phyllosphere | FEFKKMKNSQKIPKNISRCKESNGVKFSPKFVYLVWFAEFIS |
| Ga0182213_11396511 | 3300017421 | Switchgrass Phyllosphere | KFEFKKMKIPKKIPKNTSRCDESNGVKFSQKSVHLE |
| Ga0182213_12083341 | 3300017421 | Switchgrass Phyllosphere | FEFEFKKMKNSQKIPKNISRCKESNGVKFSQKFVNLVWFAEFIS |
| Ga0182213_12348112 | 3300017421 | Switchgrass Phyllosphere | VRYETGPNSKFKFEFKKMKNSQKIPKNISRCKESNGVKFSQKIVHLVWFAEFIS |
| Ga0182201_10111541 | 3300017422 | Switchgrass Phyllosphere | QTGHNSKFKFEFKKMKKSLKIPKNTTRCEESNDVKISQKFVHLA |
| Ga0182196_10416731 | 3300017432 | Switchgrass Phyllosphere | TGPNSKFKFKFKKMKNSQKIPKNTSMCDESNGVKFSQKFVHLV |
| Ga0182194_11025651 | 3300017435 | Switchgrass Phyllosphere | PVANWPNSKFKFELKKMKNSQKIPKNTSSCDKSNGVKFFQIFVHLVYFASM |
| Ga0182194_11068011 | 3300017435 | Switchgrass Phyllosphere | LVRFETGQILKFEFELIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS |
| Ga0182198_10483951 | 3300017445 | Switchgrass Phyllosphere | KFKFEFKKIKKIQKNSKYTSRCDEFNSVKFSQKFVHLVWFAEFRS |
| Ga0207866_10476911 | 3300025530 | Ionic Liquid And High Solid Enriched | WYQTGRNSNFKFKFKKMKNSQKIPKNTSRCDESNGVKFSQKFVHLV |
| Ga0207668_108906961 | 3300025972 | Switchgrass Rhizosphere | PNSKFKFELKKRKIPKNTSRCDESNGVKFSQKFVHLA |
| Ga0207648_115523822 | 3300026089 | Miscanthus Rhizosphere | PNSKFKFELKKMKNSQKIPKNTSRCDKFNGVKFSQKFVHLV |
| Ga0268328_10358801 | 3300028050 | Phyllosphere | KFEFKKMKKSQKIPKNTTRCEESNDVKLSQKFVHLA |
| Ga0268306_10207301 | 3300028054 | Phyllosphere | TGPNLKFKFKFKKMKNFQKNSKNTSRCDESNGVKFSQKFVYLL |
| Ga0268338_10026071 | 3300028055 | Phyllosphere | LVRFETGQILKFEFELIKMKNSQKISKNISRYDESNGVKFSQIFDHLVWFAEFRS |
| Ga0268330_10055652 | 3300028056 | Phyllosphere | GSDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFRS |
| Ga0268332_10422991 | 3300028058 | Phyllosphere | GRYQTGSNSKFKFEFKKMKNLQKIPKNTSRCDESNGVKFSQKFIHLV |
| Ga0268350_10363971 | 3300028063 | Phyllosphere | ATRVKKTGPNSNFKFEFQNMEKSQKILKNTSSCDESNGVKFFQIFVHLVYFASI |
| Ga0268350_10603921 | 3300028063 | Phyllosphere | INDNRMRLTCVGNFETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS |
| Ga0268340_10793681 | 3300028064 | Phyllosphere | FELIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS |
| Ga0268334_10051742 | 3300028140 | Phyllosphere | EFKKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS |
| Ga0268326_10131492 | 3300028141 | Phyllosphere | ETGQILKFEFEFIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS |
| Ga0268354_10123902 | 3300028148 | Phyllosphere | GLGRYQTGLNSKFKFEFKKMKNSQKNPKNTSRCDKFNGVKFSQKFIRLTYFSAI |
| Ga0268343_10104531 | 3300028150 | Phyllosphere | HNSKFKFEFKKMKKSQKIPKNTTRCEESNDVKLSQKFVHLA |
| Ga0268324_10147321 | 3300028251 | Phyllosphere | MKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS |
| Ga0268304_10006592 | 3300028256 | Phyllosphere | RYETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS |
| Ga0268264_105530701 | 3300028381 | Switchgrass Rhizosphere | VRYETGQILKFEYEFIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS |
| Ga0268333_10013602 | 3300028467 | Phyllosphere | YETGPNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFIS |
| Ga0268323_10058011 | 3300028471 | Phyllosphere | SGSDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFRS |
| Ga0268309_10163002 | 3300028477 | Phyllosphere | ETGPNSKFEFEFKKMKNSQKIPKNISRCKESNGVKFSQKFVHLVWFAEFIS |
| Ga0268339_10103941 | 3300028526 | Phyllosphere | QILKFEFEFIKMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS |
| Ga0268335_10008952 | 3300028527 | Phyllosphere | PNSKFKFEFKKMKKFQKIPKNTSRCDESNGVKFSQKFIRLTYFSGI |
| Ga0214492_10855371 | 3300032464 | Switchgrass Phyllosphere | GPNLKFKFEFKKNKKIPKKIPNNTSSCDEFNDVKFFQIFVHLVYFASI |
| Ga0214493_10596401 | 3300032465 | Switchgrass Phyllosphere | KMKNSQKIPKNISRYDESNGVKFSQIFDHLLWFAEFRS |
| Ga0214488_10787561 | 3300032467 | Switchgrass Phyllosphere | PNSKFKFEFKKMKNSQKIPKNTSRCNESNGVKFSPKFVHLVWFSEFLS |
| Ga0214490_10017911 | 3300032502 | Switchgrass Phyllosphere | ETGQNSKFKFKFKKMKNSQKLPKNISRCKESNGVKFSQKFVHLVWFAEFIS |
| Ga0214483_10031971 | 3300032548 | Switchgrass Phyllosphere | LVRFETGQILKFEFELIKMKNSQKIPKNISRYDESNGVKFSQIFDHLLWFA |
| Ga0214489_10293751 | 3300032590 | Switchgrass Phyllosphere | PNSNFKFEFQNMEKSQKILKNTSSCDESNGVKFFQIFVHLVYFASI |
| Ga0352977_10132132 | 3300032599 | Fungi-Associated Bovine Rumen | RTGSGSDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNGVKFSQKFVHLVWFAEFIS |
| Ga0214485_10049511 | 3300032698 | Switchgrass Phyllosphere | SGSGRLETGPNSNFKFEFEKMEKSQKIFKNTSSCDESNDVKFFQIFINLVYFASI |
| Ga0314720_10342851 | 3300032759 | Switchgrass Phyllosphere | PNSKFKFEFKKMKNSQKNPKNISRCKESNDVKFSQKFVHLVWFVEFIS |
| Ga0314754_10159132 | 3300032760 | Switchgrass Phyllosphere | SDRFPTGPNSNFEFEFKKMKNSQKIPKNISRCDESNDIKFSQKFVHLVWFAEFIS |
| Ga0314742_10392551 | 3300032781 | Switchgrass Phyllosphere | GPNSKFKFKFQKMKNSQKIPKNTSSCDESNGVKNFQIFVHLVYFAGI |
| Ga0314745_11113141 | 3300032812 | Switchgrass Phyllosphere | VAPRVYKTGSGPNSKFKFEFKKNEKFPKKIPKNTLSCDESNGVKFSQKFVRLTYFSGI |
| Ga0314740_10330181 | 3300032822 | Switchgrass Phyllosphere | NSNFKFEFKKMKNSQKIPKNISRCKESNGVKFSQKIVHLVWFAEFIS |
| Ga0314738_10028331 | 3300032959 | Switchgrass Phyllosphere | LVRFETGQILKFEFELIKMKNSQKIPKNILRYDESNGVKFSQIFDHLLWFAEFR |
| Ga0314738_10897101 | 3300032959 | Switchgrass Phyllosphere | SGLGRYQIGPNSKFKFEFKKMKNSQKIPKNTSRCDESNSVKFSQKFIHLVYFAGI |
| Ga0314761_10921831 | 3300033526 | Switchgrass Phyllosphere | KMKNSQKIPKNISRYDESNGVKFSQIFDHLVWFAEFRS |
| Ga0314760_10420932 | 3300033530 | Switchgrass Phyllosphere | GSGIGRLETGPNSNFKFEFQKMEKSQKIPQNTLRCDESNGVKFSQKFVHLV |
| Ga0314759_12401121 | 3300033535 | Switchgrass Phyllosphere | PIQNLKFEFKKIKNSQKFPKNTSSCDESNGVKFFQIFVHLVYFAGI |
| Ga0314766_12941632 | 3300033537 | Switchgrass Phyllosphere | PVHTGLNSKFKFEFKKMENSQKIPKNTSRCDESNGVKFSQKFIHLV |
| ⦗Top⦘ |