NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049431

Metagenome / Metatranscriptome Family F049431

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049431
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 159 residues
Representative Sequence MTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Number of Associated Samples 146
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 22.60 %
% of genes near scaffold ends (potentially truncated) 80.82 %
% of genes from short scaffolds (< 2000 bps) 95.21 %
Associated GOLD sequencing projects 142
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter
(32.877 % of family members)
Environment Ontology (ENVO) Unclassified
(32.877 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(45.205 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 14.20%    β-sheet: 1.23%    Coil/Unstructured: 84.57%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003316|rootH1_10025457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima2573Open in IMG/M
3300003322|rootL2_10098296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1475Open in IMG/M
3300003845|Ga0058699_1004623All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1814Open in IMG/M
3300005334|Ga0068869_101598122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima580Open in IMG/M
3300005345|Ga0070692_10566361All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima746Open in IMG/M
3300005347|Ga0070668_100802069All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima836Open in IMG/M
3300005547|Ga0070693_100242292All Organisms → cellular organisms → Eukaryota1191Open in IMG/M
3300005562|Ga0058697_10033548All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1886Open in IMG/M
3300005577|Ga0068857_100837893All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima879Open in IMG/M
3300005840|Ga0068870_10344244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima955Open in IMG/M
3300006058|Ga0075432_10143877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima912Open in IMG/M
3300007218|Ga0103964_1032604All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1545Open in IMG/M
3300009036|Ga0105244_10206715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima924Open in IMG/M
3300009093|Ga0105240_10520068All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1321Open in IMG/M
3300009177|Ga0105248_11017383All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima936Open in IMG/M
3300009972|Ga0105137_102827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima747Open in IMG/M
3300009994|Ga0105126_1013093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima822Open in IMG/M
3300010060|Ga0127425_119048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima671Open in IMG/M
3300010061|Ga0127462_116031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima675Open in IMG/M
3300010066|Ga0127427_146072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima649Open in IMG/M
3300010068|Ga0127442_125207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima685Open in IMG/M
3300010070|Ga0127441_129555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima681Open in IMG/M
3300010075|Ga0127434_118656All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima688Open in IMG/M
3300010076|Ga0127430_170533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima674Open in IMG/M
3300010081|Ga0127457_1003281All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima666Open in IMG/M
3300010098|Ga0127463_1104833All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima660Open in IMG/M
3300010107|Ga0127494_1146198All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima594Open in IMG/M
3300010119|Ga0127452_1144449All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima683Open in IMG/M
3300010127|Ga0127489_1006555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima681Open in IMG/M
3300010144|Ga0115593_1257111All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima605Open in IMG/M
3300010896|Ga0138111_1082241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima790Open in IMG/M
3300012375|Ga0134034_1099040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima678Open in IMG/M
3300012388|Ga0134031_1124122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima693Open in IMG/M
3300012389|Ga0134040_1234757All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima687Open in IMG/M
3300012721|Ga0157612_1061538All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima544Open in IMG/M
3300012725|Ga0157610_1004059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima665Open in IMG/M
3300013297|Ga0157378_10163703All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima2082Open in IMG/M
3300013871|Ga0181466_1005086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima2491Open in IMG/M
3300014236|Ga0135128_10069All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima927Open in IMG/M
3300014326|Ga0157380_10374018All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1342Open in IMG/M
3300015279|Ga0182174_1001358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1616Open in IMG/M
3300015301|Ga0182184_1005428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1284Open in IMG/M
3300015334|Ga0182132_1076873All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima695Open in IMG/M
3300015337|Ga0182151_1062059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima737Open in IMG/M
3300017424|Ga0182219_1117004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima532Open in IMG/M
3300017425|Ga0182224_1015242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1042Open in IMG/M
3300017430|Ga0182192_1089591All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima632Open in IMG/M
3300017693|Ga0182216_1060127All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima838Open in IMG/M
3300018414|Ga0194135_10117098All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1804Open in IMG/M
3300018947|Ga0193066_10158886All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima657Open in IMG/M
3300019039|Ga0193123_10269717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima668Open in IMG/M
3300020023|Ga0182178_1000055All Organisms → cellular organisms → Eukaryota4351Open in IMG/M
3300020069|Ga0197907_11388691All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima686Open in IMG/M
3300020076|Ga0206355_1590661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima593Open in IMG/M
3300020078|Ga0206352_10765241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima547Open in IMG/M
3300021060|Ga0182232_1024638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1039Open in IMG/M
3300022465|Ga0213505_113198All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima681Open in IMG/M
3300022466|Ga0213504_103092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima676Open in IMG/M
3300022750|Ga0247812_10052235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1898Open in IMG/M
3300022924|Ga0247808_10034142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2435Open in IMG/M
3300022936|Ga0247806_10134555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1039Open in IMG/M
3300023093|Ga0247735_1044416All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1863Open in IMG/M
3300023099|Ga0247803_1112203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima946Open in IMG/M
3300024483|Ga0255224_1061546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima777Open in IMG/M
3300024487|Ga0255222_1042354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima682Open in IMG/M
3300025911|Ga0207654_10008591All Organisms → cellular organisms → Eukaryota5172Open in IMG/M
3300025913|Ga0207695_11586123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima535Open in IMG/M
3300025938|Ga0207704_11219991All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima642Open in IMG/M
3300025941|Ga0207711_10907624All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima819Open in IMG/M
3300025961|Ga0207712_10652834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima914Open in IMG/M
3300026035|Ga0207703_11763857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima595Open in IMG/M
3300026116|Ga0207674_10261250All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1679Open in IMG/M
3300026415|Ga0256298_1036942All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima660Open in IMG/M
3300028113|Ga0255234_1210258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima509Open in IMG/M
3300028139|Ga0268355_1000271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1837Open in IMG/M
3300028236|Ga0302336_10018237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima2559Open in IMG/M
3300028586|Ga0265798_11001290All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima551Open in IMG/M
3300028792|Ga0307504_10068268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1061Open in IMG/M
3300029699|Ga0255233_1078425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima654Open in IMG/M
3300030501|Ga0268244_10157732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1081Open in IMG/M
3300030767|Ga0315866_109772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima684Open in IMG/M
3300030768|Ga0315877_120155All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima687Open in IMG/M
3300030792|Ga0265790_112639All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima635Open in IMG/M
3300030797|Ga0265782_107710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima688Open in IMG/M
3300030798|Ga0265781_107357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima684Open in IMG/M
3300030810|Ga0265786_109616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima689Open in IMG/M
3300030817|Ga0315864_112532All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima664Open in IMG/M
3300030818|Ga0315854_112159All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima688Open in IMG/M
3300030819|Ga0315890_109885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima694Open in IMG/M
3300030825|Ga0315874_111123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima683Open in IMG/M
3300030827|Ga0315871_110205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima687Open in IMG/M
3300030828|Ga0315869_122615All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima684Open in IMG/M
3300030890|Ga0315875_119855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima691Open in IMG/M
3300030892|Ga0315856_118092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima682Open in IMG/M
3300030893|Ga0315883_109757All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima688Open in IMG/M
3300030894|Ga0315884_117344All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima706Open in IMG/M
3300030897|Ga0315889_116110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima680Open in IMG/M
3300030900|Ga0315850_109362All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima692Open in IMG/M
3300030901|Ga0315876_111753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima701Open in IMG/M
3300030927|Ga0315873_110628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima700Open in IMG/M
3300030928|Ga0315867_106090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima689Open in IMG/M
3300030985|Ga0315858_115010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima681Open in IMG/M
3300031012|Ga0315887_117748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima686Open in IMG/M
3300031026|Ga0315862_107882All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima694Open in IMG/M
3300031045|Ga0315893_119532All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima687Open in IMG/M
3300031060|Ga0315833_110138All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima643Open in IMG/M
3300031061|Ga0315844_108801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima688Open in IMG/M
3300031065|Ga0315807_110626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima639Open in IMG/M
3300031066|Ga0315821_118845All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima642Open in IMG/M
3300031068|Ga0315819_113662All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima689Open in IMG/M
3300031070|Ga0315838_111704All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima674Open in IMG/M
3300031073|Ga0315818_118923All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima688Open in IMG/M
3300031074|Ga0315826_114094All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima644Open in IMG/M
3300031076|Ga0315813_115025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima677Open in IMG/M
3300031101|Ga0315841_115616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima681Open in IMG/M
3300031103|Ga0315810_1020112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima693Open in IMG/M
3300031104|Ga0315828_113952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima661Open in IMG/M
3300031108|Ga0315834_110783All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima681Open in IMG/M
3300031109|Ga0315824_108871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima695Open in IMG/M
3300031135|Ga0315847_118879All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima664Open in IMG/M
3300031428|Ga0315832_121625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima688Open in IMG/M
3300031478|Ga0265787_109884All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima678Open in IMG/M
3300032127|Ga0315305_1140370All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima639Open in IMG/M
3300032145|Ga0315304_1121244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima689Open in IMG/M
3300032149|Ga0315302_1068386All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima665Open in IMG/M
3300032465|Ga0214493_1097209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima700Open in IMG/M
3300032466|Ga0214503_1159890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima704Open in IMG/M
3300032468|Ga0214482_1085637All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima601Open in IMG/M
3300032490|Ga0214495_1096535All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima682Open in IMG/M
3300032548|Ga0214483_1052266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima687Open in IMG/M
3300032698|Ga0214485_1051605All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima790Open in IMG/M
3300032699|Ga0214494_1064061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima705Open in IMG/M
3300032758|Ga0314746_1020546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1408Open in IMG/M
3300032759|Ga0314720_1049290All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima500Open in IMG/M
3300032781|Ga0314742_1030652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima962Open in IMG/M
3300032789|Ga0314725_1028944All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima673Open in IMG/M
3300032822|Ga0314740_1048596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima636Open in IMG/M
3300032824|Ga0314735_1064339All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima693Open in IMG/M
3300032825|Ga0314724_119821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima666Open in IMG/M
3300032843|Ga0314736_1031677All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima687Open in IMG/M
3300032845|Ga0314727_1035002All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima698Open in IMG/M
3300032888|Ga0314728_111644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima692Open in IMG/M
3300032915|Ga0314749_1082009All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima695Open in IMG/M
3300033532|Ga0314767_1109870All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima689Open in IMG/M
3300033533|Ga0314770_1166094All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima693Open in IMG/M
3300033540|Ga0314764_1047470All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima716Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter32.88%
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere19.18%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil10.96%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.42%
Miscanthus PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere2.74%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.05%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.05%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.37%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.37%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.37%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.37%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil1.37%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated1.37%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.37%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.68%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.68%
Indoor Hospital AirEnvironmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air0.68%
FecesHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Feces0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.68%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere0.68%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere0.68%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.68%
FruitHost-Associated → Plants → Phyllosphere → Carposphere → Unclassified → Fruit0.68%
Clean RoomEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003316Sugarcane root Sample L1Host-AssociatedOpen in IMG/M
3300003322Sugarcane root Sample L2Host-AssociatedOpen in IMG/M
3300003845Agave microbial communities from Guanajuato, Mexico - At.P.eHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300007218Pinova apple microbial communities from ItalyHost-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300010060Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010061Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010066Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010068Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010070Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010075Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010076Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010081Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010098Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010107Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010119Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010127Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010144Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010896Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012375Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012388Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012389Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012721Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012725Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013871Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In4-11 gowning area SPAdes reassemblyEngineeredOpen in IMG/M
3300014236Indoor hospital air microbial communities from San Diego, USA - 176_L1_2014-5-5EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015279Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017424Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017425Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017430Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300018414Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021060Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MGHost-AssociatedOpen in IMG/M
3300022465Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300022466Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12SEP2016_LR1 MT pilot (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300022750Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L149-409B-1EnvironmentalOpen in IMG/M
3300022924Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L089-202R-1EnvironmentalOpen in IMG/M
3300022936Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L059-202B-1EnvironmentalOpen in IMG/M
3300023093Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L178-409R-2EnvironmentalOpen in IMG/M
3300023099Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L014-104B-1EnvironmentalOpen in IMG/M
3300024483Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024487Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026415Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028139Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028236Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Alfalfa, Gen10, Rep 2, Chloramphenicol (External Submission)Host-AssociatedOpen in IMG/M
3300028586Plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T30EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300029699Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030501Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030767Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T26 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030768Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030792Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030797Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T0 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030798Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T0 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030810Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030817Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T25 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030818Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T22 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030819Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T34 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030825Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T29 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030827Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T28 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030828Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T27 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030890Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T29 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030892Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T23 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030893Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030894Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030897Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T34 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030900Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T21 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030901Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T29 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030927Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T28 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030928Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T26 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030985Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T23 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031012Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T33 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031026Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T25 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031045Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T35 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031060Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T15 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031061Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T19 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031065Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031066Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T11 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031068Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031070Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T17 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031073Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031074Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T13 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031076Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T8 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031101Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T18 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031103Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031104Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T13 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031108Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T15 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031109Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031135Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T20 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031428Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T15 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031478Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032127Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_Tmax_529 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032145Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_1000m_313 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032149Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_1000m_931 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032468Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032548Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032758Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032759Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032781Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032789Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032822Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032824Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032825Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032843Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032845Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032888Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032915Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033532Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033533Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033540Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
rootH1_1002545713300003316Sugarcane Root And Bulk SoilRINQVTILSPGAEAHERTPRRRPGCTGRKGRRRSEPRPQASEAYETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYMRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSASTLQLPEGGQHRASRKESPSPK*
rootL2_1009829613300003322Sugarcane Root And Bulk SoilMTTGRINQVTILSPGAEAHERTPRRRPGCTGRKGRRRSEPRPQASEAYETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYMRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSASTLQLPEGGQHRASRKESPSPK*
Ga0058699_100462313300003845AgaveTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0068869_10159812223300005334Miscanthus RhizosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTST
Ga0070692_1056636113300005345Corn, Switchgrass And Miscanthus RhizosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK*
Ga0070668_10080206923300005347Switchgrass RhizosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK*
Ga0070693_10024229223300005547Corn, Switchgrass And Miscanthus RhizosphereMTTGRINQVTIVNPSAEAKGEPPEGGHDVPDGREKPKRPQPQASQVYETPEPRATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQQRKQEGVAEPQVDAPTRVNIVCRYMGNKACW
Ga0058697_1003354823300005562AgaveMTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0068857_10083789313300005577Corn RhizosphereMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK*
Ga0068870_1034424413300005840Miscanthus RhizosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRVLHRHIRPSGGEDPSQVNAQARILDGAIPEDLVKRLAKPAIHRPQMVPANRKTNRTSVPPASALQQPKGDQHRSSRKESPSPK*
Ga0075432_1014387713300006058Populus RhizosphereMTTGRINQVTILNPSAGASERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK*
Ga0103964_103260413300007218FruitINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0105244_1020671513300009036Miscanthus RhizosphereMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK*
Ga0105240_1052006823300009093Corn RhizosphereMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK*
Ga0105248_1101738313300009177Switchgrass RhizosphereHMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK*
Ga0105137_10282723300009972Switchgrass AssociatedMTTGRINQVTILSPSAEAHEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK*
Ga0105126_101309323300009994Switchgrass AssociatedMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARILDRAIPEDLVKRLAKPAIHRPQMLPANRETNRTSVPSTSTLQLPEGDQHRASRKESPSPK*
Ga0127425_11904813300010060Grasslands SoilRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0127462_11603113300010061Grasslands SoilRINQVTILSPGAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0127427_14607213300010066Grasslands SoilSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0127442_12520713300010068Grasslands SoilMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0127441_12955513300010070Grasslands SoilTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0127434_11865613300010075Grasslands SoilHMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0127430_17053313300010076Grasslands SoilGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0127457_100328113300010081Grasslands SoilGRINQVTILSPGAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0127463_110483313300010098Grasslands SoilRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0127494_114619813300010107Grasslands SoilIYCHYLPVSGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0127452_114444913300010119Grasslands SoilTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0127489_100655513300010127Grasslands SoilMTTGRINQVTILSPGAEAHEQTPRRRPECTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0115593_125711113300010144WetlandHMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK*
Ga0138111_108224113300010896Grasslands SoilKNMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0134034_109904013300012375Grasslands SoilGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRSRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0134031_112412213300012388Grasslands SoilKHMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0134040_123475713300012389Grasslands SoilLTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPADRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0157612_106153813300012721FreshwaterGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLRLPEGRQHRASRKESPSPK*
Ga0157610_100405913300012725FreshwaterGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK*
Ga0157378_1016370323300013297Miscanthus RhizosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0181466_100508623300013871Clean RoomHMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK*
Ga0135128_1006913300014236Indoor Hospital AirVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK*
Ga0157380_1037401823300014326Switchgrass RhizosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRLLHRYMRPSGGEDSSQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK*
Ga0182174_100135813300015279Miscanthus PhyllosphereMTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK*
Ga0182184_100542823300015301Switchgrass PhyllosphereMTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPAIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0182132_107687323300015334Switchgrass PhyllosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTQFPKLRSATGGTRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRET
Ga0182151_106205913300015337Switchgrass PhyllospherePSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0182219_111700423300017424Miscanthus PhyllosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGG
Ga0182224_101524213300017425Miscanthus PhyllosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDPIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0182192_108959123300017430Miscanthus PhyllosphereMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKSWSATSRDRCCHRKHVRYIQPSGGENPRLDTQQAAETWQSCPQRSGEYLAKPAIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0182216_106012723300017693Switchgrass PhyllosphereMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0194135_1011709813300018414WatershedsDTHMTTGRINQLTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0193066_1015888613300018947MarineEAHEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGSIRLLHRSLRRYMRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSASTLQLPKGGQHRASRKESPSPK
Ga0193123_1026971713300019039MarineSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0182178_100005513300020023Switchgrass PhyllosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0197907_1138869113300020069Corn, Switchgrass And Miscanthus RhizosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0206355_159066113300020076Corn, Switchgrass And Miscanthus RhizosphereGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0206352_1076524113300020078Corn, Switchgrass And Miscanthus RhizosphereTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0182232_102463823300021060PhyllosphereMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0213505_11319813300022465Switchgrass PhyllosphereMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0213504_10309213300022466Switchgrass PhyllosphereTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0247812_1005223513300022750Plant LitterMTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0247808_1003414223300022924Plant LitterMTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0247806_1013455523300022936Plant LitterMTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0247735_104441613300023093Plant LitterMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0247803_111220313300023099Plant LitterEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0255224_106154613300024483FreshwaterHMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0255222_104235413300024487FreshwaterTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0207654_1000859123300025911Corn RhizosphereMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0207695_1158612313300025913Corn RhizosphereMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKE
Ga0207704_1121999113300025938Miscanthus RhizosphereGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0207711_1090762413300025941Switchgrass RhizosphereKHMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0207712_1065283423300025961Switchgrass RhizosphereVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0207703_1176385713300026035Switchgrass RhizosphereLSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0207674_1026125023300026116Corn RhizosphereMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0256298_103694213300026415FreshwaterGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0255234_121025813300028113FreshwaterRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0268355_100027113300028139PhyllosphereINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0302336_1001823713300028236FecesMTTGRINQVTIVNPSAEANERTPRRRPDVPDGREKPKRPQPQASEAYKTPKPRATDSIAPTEFPKLRSATGGTRLLHRLLPRHIRPSGGEDSSQVNAQARVLDRAIPEDLVKRLAKPAIHRPQMVPASRKTSRTSVPPTSALQ
Ga0265798_1100129023300028586Plant LitterMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGRIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASR
Ga0307504_1006826813300028792SoilGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0255233_107842513300029699FreshwaterTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0268244_1015773213300030501AgaveGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315866_10977213300030767Plant LitterTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315877_12015513300030768Plant LitterMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0265790_11263913300030792Plant LitterGRINQVTILSPGAEAHEQTPRRRPECTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKELPSPK
Ga0265782_10771013300030797Plant LitterMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRRESPSPK
Ga0265781_10735713300030798Plant LitterMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRKTNRTSVPSASTLQLPEGGQHRASRKELPSPK
Ga0265786_10961613300030810Plant LitterHMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315864_11253213300030817Plant LitterVTILSPGAEAPEQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315854_11215913300030818Plant LitterMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315890_10988513300030819Plant LitterHMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASQVCETPKPQAPDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315874_11112313300030825Plant LitterTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315871_11020513300030827Plant LitterMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315869_12261513300030828Plant LitterTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315875_11985513300030890Plant LitterHVTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315856_11809213300030892Plant LitterTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315883_10975713300030893Plant LitterHMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315884_11734413300030894Plant LitterHMTTGRINQVTILSPGAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315889_11611013300030897Plant LitterGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315850_10936213300030900Plant LitterHMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRKTNRTSVPSASTLQLPEGGQHRASRKELPSPK
Ga0315876_11175313300030901Plant LitterDEHMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315873_11062813300030927Plant LitterDKHMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315867_10609013300030928Plant LitterMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315858_11501013300030985Plant LitterGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKELPSPK
Ga0315887_11774813300031012Plant LitterHMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315862_10788213300031026Plant LitterHMTTGRINQVTILSPGAEAPEQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGTRSLHRLLLRHIRPSGGEDPSQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315893_11953213300031045Plant LitterTTGRINQVTILSPGAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315833_11013813300031060Plant LitterVTILSPGAEAPEQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315844_10880113300031061Plant LitterTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315807_11062613300031065Plant LitterGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315821_11884513300031066Plant LitterHMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSASTLQLPEGGQHRASRKELPSPK
Ga0315819_11366213300031068Plant LitterTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315838_11170413300031070Plant LitterINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315818_11892313300031073Plant LitterTTGRINQVTILSPGAEAPEQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315826_11409413300031074Plant LitterAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315813_11502513300031076Plant LitterRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315841_11561613300031101Plant LitterGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKELPSPK
Ga0315810_102011213300031103Plant LitterHMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315828_11395213300031104Plant LitterTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315834_11078313300031108Plant LitterGRINQVTILSPGAEAHEQTPRRRPECTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRRESPSPK
Ga0315824_10887113300031109Plant LitterHMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0315847_11887913300031135Plant LitterTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315832_12162513300031428Plant LitterHMTTGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKELPSPK
Ga0265787_10988413300031478Plant LitterGRINQVTILSPSAEAPEQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315305_114037013300032127MarineVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315304_112124413300032145MarineMTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETHKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0315302_106838613300032149MarineGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0214493_109720913300032465Switchgrass PhyllosphereDKHMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0214503_115989023300032466Switchgrass PhyllosphereHMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0214482_108563713300032468Switchgrass PhyllosphereTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0214495_109653513300032490Switchgrass PhyllosphereTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0214483_105226613300032548Switchgrass PhyllosphereATGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0214485_105160513300032698Switchgrass PhyllosphereHMTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0214494_106406113300032699Switchgrass PhyllosphereFETSNMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0314746_102054623300032758Switchgrass PhyllosphereDKHMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0314720_104929013300032759Switchgrass PhyllosphereGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0314742_103065223300032781Switchgrass PhyllosphereHMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0314725_102894413300032789Switchgrass PhyllosphereGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0314740_104859613300032822Switchgrass PhyllosphereHMTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0314735_106433913300032824Switchgrass PhyllosphereHMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0314724_11982113300032825Switchgrass PhyllosphereGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0314736_103167713300032843Switchgrass PhyllosphereTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0314727_103500213300032845Switchgrass PhyllosphereDEHMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0314728_11164413300032888Switchgrass PhyllosphereHMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0314749_108200913300032915Switchgrass PhyllosphereHMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0314767_110987013300033532Switchgrass PhyllosphereHMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0314770_116609413300033533Switchgrass PhyllosphereHMTTGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK
Ga0314764_104747013300033540Switchgrass PhyllosphereRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.