 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F104214 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | RIMWSMYCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 47.47 % |
| % of genes near scaffold ends (potentially truncated) | 83.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (59.000 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (90.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (98.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (52.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.08% β-sheet: 0.00% Coil/Unstructured: 77.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF03055 | RPE65 | 6.00 |
| PF16712 | SCAB_CC | 4.00 |
| PF00013 | KH_1 | 3.00 |
| PF10250 | O-FucT | 1.00 |
| PF00225 | Kinesin | 1.00 |
| PF08519 | RFC1 | 1.00 |
| PF02878 | PGM_PMM_I | 1.00 |
| PF14541 | TAXi_C | 1.00 |
| PF00498 | FHA | 1.00 |
| PF01148 | CTP_transf_1 | 1.00 |
| PF01636 | APH | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG3670 | Carotenoid cleavage dioxygenase or a related enzyme | Secondary metabolites biosynthesis, transport and catabolism [Q] | 6.00 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.00 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.00 % |
| Unclassified | root | N/A | 41.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005344|Ga0070661_100553016 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 926 | Open in IMG/M |
| 3300005457|Ga0070662_100972106 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 726 | Open in IMG/M |
| 3300009995|Ga0105139_1086955 | Not Available | 593 | Open in IMG/M |
| 3300015290|Ga0182105_1022321 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 845 | Open in IMG/M |
| 3300015293|Ga0182103_1055048 | Not Available | 621 | Open in IMG/M |
| 3300015312|Ga0182168_1012758 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1124 | Open in IMG/M |
| 3300015312|Ga0182168_1017605 | Not Available | 1022 | Open in IMG/M |
| 3300015312|Ga0182168_1134994 | Not Available | 505 | Open in IMG/M |
| 3300015316|Ga0182121_1025649 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 957 | Open in IMG/M |
| 3300015317|Ga0182136_1002997 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1674 | Open in IMG/M |
| 3300015317|Ga0182136_1056073 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 711 | Open in IMG/M |
| 3300015320|Ga0182165_1015953 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1100 | Open in IMG/M |
| 3300015320|Ga0182165_1101720 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 584 | Open in IMG/M |
| 3300015325|Ga0182148_1123451 | Not Available | 537 | Open in IMG/M |
| 3300015326|Ga0182166_1016604 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1038 | Open in IMG/M |
| 3300015326|Ga0182166_1124069 | Not Available | 535 | Open in IMG/M |
| 3300015329|Ga0182135_1053551 | Not Available | 752 | Open in IMG/M |
| 3300015331|Ga0182131_1034249 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 881 | Open in IMG/M |
| 3300015333|Ga0182147_1116819 | Not Available | 588 | Open in IMG/M |
| 3300015334|Ga0182132_1120506 | Not Available | 581 | Open in IMG/M |
| 3300015334|Ga0182132_1121476 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 579 | Open in IMG/M |
| 3300015335|Ga0182116_1013046 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1304 | Open in IMG/M |
| 3300015335|Ga0182116_1031335 | Not Available | 993 | Open in IMG/M |
| 3300015336|Ga0182150_1017769 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 1104 | Open in IMG/M |
| 3300015337|Ga0182151_1133279 | Not Available | 551 | Open in IMG/M |
| 3300015338|Ga0182137_1031556 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 989 | Open in IMG/M |
| 3300015348|Ga0182115_1008239 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 2199 | Open in IMG/M |
| 3300015348|Ga0182115_1093526 | Not Available | 939 | Open in IMG/M |
| 3300015348|Ga0182115_1181088 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 675 | Open in IMG/M |
| 3300015348|Ga0182115_1240427 | Not Available | 577 | Open in IMG/M |
| 3300015348|Ga0182115_1286384 | Not Available | 521 | Open in IMG/M |
| 3300015349|Ga0182185_1048805 | Not Available | 1107 | Open in IMG/M |
| 3300015349|Ga0182185_1213725 | Not Available | 585 | Open in IMG/M |
| 3300015350|Ga0182163_1003456 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 2683 | Open in IMG/M |
| 3300015350|Ga0182163_1024328 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1526 | Open in IMG/M |
| 3300015350|Ga0182163_1071716 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1017 | Open in IMG/M |
| 3300015350|Ga0182163_1266549 | Not Available | 537 | Open in IMG/M |
| 3300015352|Ga0182169_1006527 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2444 | Open in IMG/M |
| 3300015352|Ga0182169_1113833 | Not Available | 872 | Open in IMG/M |
| 3300015353|Ga0182179_1143569 | Not Available | 741 | Open in IMG/M |
| 3300015353|Ga0182179_1144623 | Not Available | 738 | Open in IMG/M |
| 3300015354|Ga0182167_1007327 | Not Available | 2637 | Open in IMG/M |
| 3300015354|Ga0182167_1060100 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 1329 | Open in IMG/M |
| 3300015354|Ga0182167_1112393 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1000 | Open in IMG/M |
| 3300015354|Ga0182167_1132354 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 920 | Open in IMG/M |
| 3300017412|Ga0182199_1103777 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 656 | Open in IMG/M |
| 3300028049|Ga0268322_1000535 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1831 | Open in IMG/M |
| 3300028050|Ga0268328_1042730 | Not Available | 609 | Open in IMG/M |
| 3300028056|Ga0268330_1017101 | Not Available | 786 | Open in IMG/M |
| 3300028056|Ga0268330_1048857 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 551 | Open in IMG/M |
| 3300028058|Ga0268332_1052325 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 588 | Open in IMG/M |
| 3300028064|Ga0268340_1052266 | Not Available | 607 | Open in IMG/M |
| 3300028475|Ga0268327_1003131 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 928 | Open in IMG/M |
| 3300032464|Ga0214492_1085719 | Not Available | 596 | Open in IMG/M |
| 3300032464|Ga0214492_1091969 | Not Available | 569 | Open in IMG/M |
| 3300032465|Ga0214493_1000669 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 3888 | Open in IMG/M |
| 3300032465|Ga0214493_1017117 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1525 | Open in IMG/M |
| 3300032465|Ga0214493_1019113 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1466 | Open in IMG/M |
| 3300032465|Ga0214493_1031875 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1199 | Open in IMG/M |
| 3300032466|Ga0214503_1028506 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1577 | Open in IMG/M |
| 3300032467|Ga0214488_1100758 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 626 | Open in IMG/M |
| 3300032469|Ga0214491_1106806 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 671 | Open in IMG/M |
| 3300032490|Ga0214495_1150934 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 514 | Open in IMG/M |
| 3300032502|Ga0214490_1012021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1657 | Open in IMG/M |
| 3300032514|Ga0214502_1410393 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 508 | Open in IMG/M |
| 3300032548|Ga0214483_1001921 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 2347 | Open in IMG/M |
| 3300032589|Ga0214500_1107884 | Not Available | 793 | Open in IMG/M |
| 3300032591|Ga0214484_1009111 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1724 | Open in IMG/M |
| 3300032592|Ga0214504_1100875 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 562 | Open in IMG/M |
| 3300032593|Ga0321338_1233181 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 661 | Open in IMG/M |
| 3300032689|Ga0214497_1086264 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 689 | Open in IMG/M |
| 3300032689|Ga0214497_1140841 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 501 | Open in IMG/M |
| 3300032698|Ga0214485_1029908 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1025 | Open in IMG/M |
| 3300032699|Ga0214494_1010831 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1530 | Open in IMG/M |
| 3300032699|Ga0214494_1053782 | Not Available | 775 | Open in IMG/M |
| 3300032759|Ga0314720_1014685 | Not Available | 958 | Open in IMG/M |
| 3300032761|Ga0314733_1070861 | Not Available | 666 | Open in IMG/M |
| 3300032790|Ga0314731_1065781 | Not Available | 595 | Open in IMG/M |
| 3300032792|Ga0314744_1002537 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 2554 | Open in IMG/M |
| 3300032824|Ga0314735_1013112 | Not Available | 1414 | Open in IMG/M |
| 3300032825|Ga0314724_102710 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1623 | Open in IMG/M |
| 3300032825|Ga0314724_124429 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 587 | Open in IMG/M |
| 3300032826|Ga0314732_107220 | Not Available | 1109 | Open in IMG/M |
| 3300032844|Ga0314743_1054666 | Not Available | 934 | Open in IMG/M |
| 3300032844|Ga0314743_1101136 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 661 | Open in IMG/M |
| 3300032845|Ga0314727_1009076 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1295 | Open in IMG/M |
| 3300032875|Ga0314737_1002025 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 2328 | Open in IMG/M |
| 3300032916|Ga0314734_1059869 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 768 | Open in IMG/M |
| 3300032934|Ga0314741_1093535 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 696 | Open in IMG/M |
| 3300032959|Ga0314738_1061209 | Not Available | 680 | Open in IMG/M |
| 3300032966|Ga0314722_1078294 | Not Available | 504 | Open in IMG/M |
| 3300033523|Ga0314768_1010818 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 2377 | Open in IMG/M |
| 3300033526|Ga0314761_1021710 | Not Available | 1330 | Open in IMG/M |
| 3300033530|Ga0314760_1046352 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1071 | Open in IMG/M |
| 3300033530|Ga0314760_1119222 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 649 | Open in IMG/M |
| 3300033532|Ga0314767_1050778 | Not Available | 1007 | Open in IMG/M |
| 3300033533|Ga0314770_1046291 | Not Available | 1289 | Open in IMG/M |
| 3300033535|Ga0314759_1080711 | Not Available | 1007 | Open in IMG/M |
| 3300033539|Ga0314762_1095886 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 549 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 90.00% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 7.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.00% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032548 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032592 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032699 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032759 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032790 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032824 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032825 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032826 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032845 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032875 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032966 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033533 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033539 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070661_1005530161 | 3300005344 | Corn Rhizosphere | MCRMYCIEPLGRIYKST*LGGQEAYPRDKEGYPRYQEGYPGITINPKPTIS |
| Ga0070662_1009721062 | 3300005457 | Corn Rhizosphere | MCGMYCIEPLERIYRST*LGGQEAYPRDKECYPRYKEGYPGITINPKPTISGVA* |
| Ga0105139_10869552 | 3300009995 | Switchgrass Associated | RIMRSMYCIEPLGGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISVVA* |
| Ga0182102_10456742 | 3300015273 | Switchgrass Phyllosphere | VYDAWDVLHEPLGRIYRITWLGGQVASPRDKEGYPGITINPKLTI |
| Ga0182105_10223211 | 3300015290 | Switchgrass Phyllosphere | MMRGMYCIEPLGRIYRNTWLGGQVASPRDKEGYPGITINTKLTISRVA* |
| Ga0182103_10550481 | 3300015293 | Switchgrass Phyllosphere | MRGIYCFEPLGRIYRSTWLGGQVASPRDKEGYPGITINPK |
| Ga0182168_10127581 | 3300015312 | Switchgrass Phyllosphere | MRGMYCIEPLGQICRSTWLGGQVASPRDKEGYPGITINPKLT |
| Ga0182168_10176052 | 3300015312 | Switchgrass Phyllosphere | MWSMYCIEALGRLYRTTWLGGQVASPRDKEGYPGITTNPKLTISGVA* |
| Ga0182168_11349941 | 3300015312 | Switchgrass Phyllosphere | ESRMRIMWSMYCIESLGRIYRSSWLGGQVASPRDKEGYFGITINPKPTISGVA* |
| Ga0182121_10256491 | 3300015316 | Switchgrass Phyllosphere | MRGMYCIEPLGRIYRSTWIGGQVASPRDKEGYPGITINPKLTISGVV* |
| Ga0182136_10029971 | 3300015317 | Switchgrass Phyllosphere | MHRMYCIEPLGRIYRSTWLVGQVASPRDKEGCPRITINPKLT |
| Ga0182136_10560731 | 3300015317 | Switchgrass Phyllosphere | RIMWSMYCIESLGRIYRSSWLGGQVASPRDKEGYFGITINPKPTISGVA* |
| Ga0182165_10159532 | 3300015320 | Switchgrass Phyllosphere | MRIIRSMYCIESLGRIYRSTWLGGQVASPRDKEGYPG |
| Ga0182165_11017202 | 3300015320 | Switchgrass Phyllosphere | VRLDIMRGMYCIEPLGRIYRSTWIGGQVASPRDKEGYPGITINPKLTISGVV* |
| Ga0182148_11234511 | 3300015325 | Switchgrass Phyllosphere | GMYCIEPLGRIYRSTWLEGQVASPKDKKGYPGITINPKVTISGVV* |
| Ga0182166_10166041 | 3300015326 | Switchgrass Phyllosphere | ESRMRIMWSIYYLSPLGGIYRSTWLGGQVGSPRDKEGYPGTTINPKLTISGVA* |
| Ga0182166_11240691 | 3300015326 | Switchgrass Phyllosphere | MRGMCCIEPLGRIYWSTWLGGQVASPRDKEGYPGI |
| Ga0182135_10535512 | 3300015329 | Switchgrass Phyllosphere | IYCIEPLGRYIQSTWFGGQVASPRDKEGYPGITIYHKLTISGVA* |
| Ga0182131_10342491 | 3300015331 | Switchgrass Phyllosphere | MWSMYCIEPLGRIYWSTWLGGQVASPRDKEGYPGITINP |
| Ga0182147_11168191 | 3300015333 | Switchgrass Phyllosphere | MWSMYCIEALGLGGQVASPRDKEGYPGITTNHKLTISGVA* |
| Ga0182132_11205061 | 3300015334 | Switchgrass Phyllosphere | MRGMYCIEPLGRIYRSTWLGVQVASLRDKEGYPGITINPKLTIS |
| Ga0182132_11214761 | 3300015334 | Switchgrass Phyllosphere | MRVMWSMYCIEPLGRIYRSTWLGGQVASPRDKEGYPGITIN |
| Ga0182116_10130461 | 3300015335 | Switchgrass Phyllosphere | MRGMYCLSHLGSLYRSTWLGGQVASLRDKEGYPGITINPKLTISGVA* |
| Ga0182116_10313352 | 3300015335 | Switchgrass Phyllosphere | MWSMYCIEPLGRIYWSTWLGGQVASPRDKEGYPGITINPKLT |
| Ga0182150_10177691 | 3300015336 | Switchgrass Phyllosphere | DWVIMRGMCCIEPLGRIYWSTWLEGQVASPRDKEDYPGKSILH* |
| Ga0182151_11332791 | 3300015337 | Switchgrass Phyllosphere | VYIAWDDCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINP |
| Ga0182137_10315561 | 3300015338 | Switchgrass Phyllosphere | MRIMWSMYCIESLGRIYRSTWLGGQVASPRNKEGYPGITIN |
| Ga0182115_10082395 | 3300015348 | Switchgrass Phyllosphere | MRSIYCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINP |
| Ga0182115_10935261 | 3300015348 | Switchgrass Phyllosphere | MWSMYCIESLGRIYRSSWLGGQVASPRDKECYLGITI |
| Ga0182115_11810881 | 3300015348 | Switchgrass Phyllosphere | MRSMYCIEPLGRIYRSTWLGGQIASPRDKEGYPGITINPKLTISGVA |
| Ga0182115_12404271 | 3300015348 | Switchgrass Phyllosphere | MYCIEPLGRIYRSTWLGGQVASPRDKKGYPGITINPKVTISGVV* |
| Ga0182115_12863841 | 3300015348 | Switchgrass Phyllosphere | MCGIYCLSHLGRIYRSTWLGGQVASPRDKKGYPGITINP |
| Ga0182185_10488051 | 3300015349 | Switchgrass Phyllosphere | MRIIWSMYCIEPLRRIYRSTWLGGQVASPRDKEGYLEITINPNLTISG |
| Ga0182185_12137252 | 3300015349 | Switchgrass Phyllosphere | RIMWSMYCIEPLDGIYRSTWLGGQVDFPRDKEGYPGITINAKLTISGVA* |
| Ga0182163_10034561 | 3300015350 | Switchgrass Phyllosphere | MWSMYCIEPLGRIYRSTWPRGQVASHRDKEGYPGITINPKLTISRDATEVD* |
| Ga0182163_10243281 | 3300015350 | Switchgrass Phyllosphere | MRGIYCIEPLVRIYMSIWLGEQVTSPRDKEGYPGITINPKLTISGVA* |
| Ga0182163_10717161 | 3300015350 | Switchgrass Phyllosphere | MRSMYCIEPLGRIYRSTWLGGQVASPRDKEDYPGITINPKLTIS |
| Ga0182163_12665491 | 3300015350 | Switchgrass Phyllosphere | RIMWSMYCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA* |
| Ga0182169_10065274 | 3300015352 | Switchgrass Phyllosphere | MYCIEALGLGGQVASPRDKEGYPGITTNPKLTISGVA* |
| Ga0182169_11138331 | 3300015352 | Switchgrass Phyllosphere | MRSIYCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA* |
| Ga0182179_11435691 | 3300015353 | Switchgrass Phyllosphere | IMWSMYCIEPLGRIYRITCLGGQVASPRDKEGYLGITINPKPTISGVD* |
| Ga0182179_11446231 | 3300015353 | Switchgrass Phyllosphere | VYDVWNVYCIETLE*IYRST*PGGQVASPRDKRGYLENIINPELTISRVAQ |
| Ga0182167_10073273 | 3300015354 | Switchgrass Phyllosphere | MRIMHVMYCIGSLGRIYRSTWLGGQIASPRDKEGYPEITINPKLTISGVA* |
| Ga0182167_10601002 | 3300015354 | Switchgrass Phyllosphere | MHGIYCIEPLGLIYSSTWHGGQVASHRDKEGYPGI |
| Ga0182167_11123931 | 3300015354 | Switchgrass Phyllosphere | MRIMWSMYCIEPFGQYICTWLGGQVTSPRDKEGYPGITINSKLTISGVA* |
| Ga0182167_11323541 | 3300015354 | Switchgrass Phyllosphere | VVEYCIEPLERIYRSTWLGGHVASPRDKEGCPGITINPKL |
| Ga0182199_11037772 | 3300017412 | Switchgrass Phyllosphere | CIEPLGRIYRSTWLGEKVASPRDKEDYPGITINSN |
| Ga0268322_10005351 | 3300028049 | Phyllosphere | MRIIRSMYCIESLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTIPGV |
| Ga0268328_10427301 | 3300028050 | Phyllosphere | MWSMYCIEPLGRIYRSTWLGGQVASPRDKEGYPGVTIN |
| Ga0268330_10171011 | 3300028056 | Phyllosphere | MWSMYCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTI |
| Ga0268330_10488572 | 3300028056 | Phyllosphere | MRIIRLMYCIESLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTI |
| Ga0268332_10523252 | 3300028058 | Phyllosphere | MRGIYCIEPPGRIYRSTWLGGQVASPRDKDGYPGITINPKLTISNVAL |
| Ga0268340_10522661 | 3300028064 | Phyllosphere | MRAIYCIEPLGQIYRSTWFGGQVVSPRDNEDYYGITINPKL |
| Ga0268327_10031312 | 3300028475 | Phyllosphere | DAMLEGRMRIMWSMYCLSPLGGIYRSTWLGGQVASPRDKEGYSGITINPKLTISGVA |
| Ga0214492_10857191 | 3300032464 | Switchgrass Phyllosphere | MWSMYCIEPLGRIYRSTWLGGQVASPRDKKGYPGITINPKLTISGV |
| Ga0214492_10919692 | 3300032464 | Switchgrass Phyllosphere | CIEPLGRIYRSTWLGGQVASPRDKKGYPGITINPKVTISGVV |
| Ga0214493_10006691 | 3300032465 | Switchgrass Phyllosphere | MHGIYCIEPLGLIYSSTWHGGQVASHRDKEGYPGITINPKLTISGVA |
| Ga0214493_10171172 | 3300032465 | Switchgrass Phyllosphere | SMYCMESLGRIYRSSWLGGQVASPRDKEGYFGITINPKPTISGVA |
| Ga0214493_10191132 | 3300032465 | Switchgrass Phyllosphere | MRIMWLMYCIEPIGRIYRSTWLRGQVASPRDKESYPGITINPKLTISEVA |
| Ga0214493_10318751 | 3300032465 | Switchgrass Phyllosphere | MRIMWSMYCIELLGRIYRSTWLGGQVASPRDKECYSG |
| Ga0214503_10285063 | 3300032466 | Switchgrass Phyllosphere | MRIMWSMYCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
| Ga0214488_11007582 | 3300032467 | Switchgrass Phyllosphere | MRIMWSMYCIEPLGRLYRSTWLGGQVASPRDKEGYPGITTN |
| Ga0214491_11068061 | 3300032469 | Switchgrass Phyllosphere | MRSMYCIEPLGRIYRSTWLGGQVASPRDKEGYPGITI |
| Ga0214495_11509341 | 3300032490 | Switchgrass Phyllosphere | MRIMWSMYCIEPIGQIYRSTWLRGQVASPRDKESYPGITINPKLTISEVA |
| Ga0214490_10120212 | 3300032502 | Switchgrass Phyllosphere | MRIMWSMYCIEPIGRIYRSTWLGGQVASPRDKEGYPGITINPKLTI |
| Ga0214502_14103931 | 3300032514 | Switchgrass Phyllosphere | MRIMWSMYCIEPIGRYIYRSTWLGGQVASTRDKKGYLGITINPKLTISGVT |
| Ga0214483_10019213 | 3300032548 | Switchgrass Phyllosphere | MYCIEALGLGGQVASPRDKEGYPGITTNPKLTISGVA |
| Ga0214500_11078841 | 3300032589 | Switchgrass Phyllosphere | CIEPLGRIYRSTWLGGQVASPRDKKSYPGITINPKATISGVV |
| Ga0214484_10091112 | 3300032591 | Switchgrass Phyllosphere | MRIMWSMYCIEPIGRIYRSTWLGGQVASPRDKEGYPGIT |
| Ga0214504_11008751 | 3300032592 | Switchgrass Phyllosphere | SRMRIMWSMYCIEALGLGGQVASPRDKEGYPGITTNPKLTISGVA |
| Ga0321338_12331811 | 3300032593 | Switchgrass Phyllosphere | MRIMWSIYYLSPLGGIYRSTWLGGQVGSPRDKEGYPGTTINPKLT |
| Ga0214497_10862641 | 3300032689 | Switchgrass Phyllosphere | MRSMYCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINPKL |
| Ga0214497_11408412 | 3300032689 | Switchgrass Phyllosphere | MRSMYCIEPLGGGIYRSTWLGGQVASPRDKEGYPGITI |
| Ga0214485_10299082 | 3300032698 | Switchgrass Phyllosphere | RIMWSMYCIEPIGRIYRSTWLGGQVASPRDKEGYPGITINHKLTISEVA |
| Ga0214494_10108311 | 3300032699 | Switchgrass Phyllosphere | RMRIMRSMYCIEPLGGGIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA |
| Ga0214494_10537821 | 3300032699 | Switchgrass Phyllosphere | CIEPLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
| Ga0314720_10146851 | 3300032759 | Switchgrass Phyllosphere | MWSMYCIEALGRLYRTTWLGGQVASPRDKEGYPGITTNPKLTISGVA |
| Ga0314733_10708611 | 3300032761 | Switchgrass Phyllosphere | MYCIESLGRIYRSSWLGGQVASPRDKEGYFGITINPKPTLSGVA |
| Ga0314731_10657811 | 3300032790 | Switchgrass Phyllosphere | VYIAWDDCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISG |
| Ga0314744_10025371 | 3300032792 | Switchgrass Phyllosphere | IMWSMYCIEPLERIYRSTWFGGQVAFSRDKEGYPGITINHKLTISGVA |
| Ga0314735_10131124 | 3300032824 | Switchgrass Phyllosphere | RLMPCRKGRMRIMWSIYCIEPLGRIYRSTWLGGQIASPRDKEGYPGITINPKLTISGVA |
| Ga0314724_1027103 | 3300032825 | Switchgrass Phyllosphere | MWSMYCIEPLGRLYRSTWLGGQVASPRDKEGYPGITINPKL |
| Ga0314724_1244291 | 3300032825 | Switchgrass Phyllosphere | EALGRLYRTTWLGGQVASPRDKEGYPGITTNPKLTISGVA |
| Ga0314732_1072201 | 3300032826 | Switchgrass Phyllosphere | VWTVRLGTMSGMYCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA |
| Ga0314743_10546663 | 3300032844 | Switchgrass Phyllosphere | RIMRSMYCIESLGRIYRSTWLGGQVTSPRDKEGYPGITINPKLTISGVA |
| Ga0314743_11011361 | 3300032844 | Switchgrass Phyllosphere | MRSMYCIEPLGRIHRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
| Ga0314727_10090762 | 3300032845 | Switchgrass Phyllosphere | MYCIEALGRLYRTTWLGGQVASPRDKEGYPGITTNPKLTISGVA |
| Ga0314737_10020252 | 3300032875 | Switchgrass Phyllosphere | MRIMWSMYCIEALGLGGQVASPRDKEGYPGITTNPKLTISGVA |
| Ga0314734_10598692 | 3300032916 | Switchgrass Phyllosphere | MRSMYCIEPLGRIYRSTWLGGQVTSPRDKEGYPGITINPKL |
| Ga0314741_10935351 | 3300032934 | Switchgrass Phyllosphere | MRSMYCMESLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTIS |
| Ga0314738_10612092 | 3300032959 | Switchgrass Phyllosphere | MRGMYCLSLLGSLYRSTWLGGQVASPRDKEGYPGITINPKL |
| Ga0314722_10782941 | 3300032966 | Switchgrass Phyllosphere | AAHEIICRKGRMRIMWSMYCIELLGRIYRSTCLGGQVASPRDKEGYPGITINPKLTISGV |
| Ga0314768_10108183 | 3300033523 | Switchgrass Phyllosphere | MRIMWSMYCIEALGRLYRTTWLGGQVASPRDKEGYPGITTNPKLTISGVA |
| Ga0314761_10217101 | 3300033526 | Switchgrass Phyllosphere | DDCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISGVA |
| Ga0314760_10463521 | 3300033530 | Switchgrass Phyllosphere | GRMRIMWSMYCIEPIGRIYRSTWLEGQVASPRDKEGYPGITINPKLTISEVA |
| Ga0314760_11192221 | 3300033530 | Switchgrass Phyllosphere | MRSMYCIEPLGRIYRSTWLGGQIASPRDKEGYPEITINPKLT |
| Ga0314767_10507781 | 3300033532 | Switchgrass Phyllosphere | MMRIMWSMYCLSPLDGIYRSTWLGGQVASSRDKEGYPGITINPKLTISGV |
| Ga0314770_10462911 | 3300033533 | Switchgrass Phyllosphere | KGMMRIMWSIYCIEPLGRIHRSTWLGGQVASPRDKEGYPEITINPKLTISGVA |
| Ga0314759_10807111 | 3300033535 | Switchgrass Phyllosphere | MRIMWSMYCIEPLGRIYRSIWFGGQLTSPRDKEGYLGSTINPK |
| Ga0314762_10958861 | 3300033539 | Switchgrass Phyllosphere | MRIMWLMYCIEPIGRIYRSTWLRGQVASPRDKEGY |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |