Basic Information | |
---|---|
Family ID | F035610 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 171 |
Average Sequence Length | 48 residues |
Representative Sequence | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIG |
Number of Associated Samples | 128 |
Number of Associated Scaffolds | 171 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 50.29 % |
% of genes near scaffold ends (potentially truncated) | 42.69 % |
% of genes from short scaffolds (< 2000 bps) | 98.83 % |
Associated GOLD sequencing projects | 125 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (85.965 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (56.140 % of family members) |
Environment Ontology (ENVO) | Unclassified (79.532 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (58.480 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.41% β-sheet: 0.00% Coil/Unstructured: 43.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 85.96 % |
All Organisms | root | All Organisms | 14.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005330|Ga0070690_100654779 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 802 | Open in IMG/M |
3300005347|Ga0070668_101240150 | Not Available | 676 | Open in IMG/M |
3300005353|Ga0070669_101292376 | Not Available | 632 | Open in IMG/M |
3300005353|Ga0070669_101564730 | Not Available | 574 | Open in IMG/M |
3300005355|Ga0070671_100465413 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1085 | Open in IMG/M |
3300005355|Ga0070671_100576497 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 971 | Open in IMG/M |
3300005367|Ga0070667_101569414 | Not Available | 618 | Open in IMG/M |
3300005438|Ga0070701_10602286 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 728 | Open in IMG/M |
3300005445|Ga0070708_101020395 | Not Available | 776 | Open in IMG/M |
3300005544|Ga0070686_101365627 | Not Available | 594 | Open in IMG/M |
3300005544|Ga0070686_101812596 | Not Available | 519 | Open in IMG/M |
3300005617|Ga0068859_100833882 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1008 | Open in IMG/M |
3300005618|Ga0068864_101733779 | Not Available | 629 | Open in IMG/M |
3300005618|Ga0068864_101872466 | Not Available | 605 | Open in IMG/M |
3300005841|Ga0068863_100790002 | Not Available | 946 | Open in IMG/M |
3300005841|Ga0068863_101475050 | Not Available | 688 | Open in IMG/M |
3300009011|Ga0105251_10406600 | Not Available | 626 | Open in IMG/M |
3300009092|Ga0105250_10243618 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 767 | Open in IMG/M |
3300009092|Ga0105250_10509170 | Not Available | 547 | Open in IMG/M |
3300009972|Ga0105137_101172 | Not Available | 940 | Open in IMG/M |
3300009976|Ga0105128_104209 | Not Available | 819 | Open in IMG/M |
3300009980|Ga0105135_128426 | Not Available | 520 | Open in IMG/M |
3300009985|Ga0105036_110106 | Not Available | 818 | Open in IMG/M |
3300009989|Ga0105131_111415 | Not Available | 773 | Open in IMG/M |
3300009990|Ga0105132_129638 | Not Available | 581 | Open in IMG/M |
3300009992|Ga0105120_1006328 | Not Available | 1055 | Open in IMG/M |
3300009994|Ga0105126_1009615 | Not Available | 903 | Open in IMG/M |
3300009994|Ga0105126_1038793 | Not Available | 581 | Open in IMG/M |
3300009994|Ga0105126_1040475 | Not Available | 573 | Open in IMG/M |
3300010371|Ga0134125_11334054 | Not Available | 782 | Open in IMG/M |
3300010373|Ga0134128_11442369 | Not Available | 758 | Open in IMG/M |
3300010399|Ga0134127_10753210 | Not Available | 1019 | Open in IMG/M |
3300010399|Ga0134127_11925028 | Not Available | 668 | Open in IMG/M |
3300010400|Ga0134122_12815914 | Not Available | 539 | Open in IMG/M |
3300012949|Ga0153798_10275066 | Not Available | 553 | Open in IMG/M |
3300013306|Ga0163162_12106584 | Not Available | 647 | Open in IMG/M |
3300014968|Ga0157379_11929250 | Not Available | 582 | Open in IMG/M |
3300015280|Ga0182100_1010962 | Not Available | 1005 | Open in IMG/M |
3300015284|Ga0182101_1029866 | Not Available | 749 | Open in IMG/M |
3300015290|Ga0182105_1100846 | Not Available | 516 | Open in IMG/M |
3300015293|Ga0182103_1008258 | Not Available | 1064 | Open in IMG/M |
3300015293|Ga0182103_1034251 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 716 | Open in IMG/M |
3300015293|Ga0182103_1085539 | Not Available | 538 | Open in IMG/M |
3300015297|Ga0182104_1028890 | Not Available | 816 | Open in IMG/M |
3300015297|Ga0182104_1056387 | Not Available | 659 | Open in IMG/M |
3300015297|Ga0182104_1099606 | Not Available | 540 | Open in IMG/M |
3300015301|Ga0182184_1070133 | Not Available | 572 | Open in IMG/M |
3300015306|Ga0182180_1039735 | Not Available | 686 | Open in IMG/M |
3300015309|Ga0182098_1032804 | Not Available | 797 | Open in IMG/M |
3300015309|Ga0182098_1059744 | Not Available | 657 | Open in IMG/M |
3300015309|Ga0182098_1071306 | Not Available | 619 | Open in IMG/M |
3300015310|Ga0182162_1118704 | Not Available | 520 | Open in IMG/M |
3300015311|Ga0182182_1036127 | Not Available | 767 | Open in IMG/M |
3300015311|Ga0182182_1079790 | Not Available | 588 | Open in IMG/M |
3300015312|Ga0182168_1092156 | Not Available | 588 | Open in IMG/M |
3300015315|Ga0182120_1042423 | Not Available | 781 | Open in IMG/M |
3300015319|Ga0182130_1076900 | Not Available | 624 | Open in IMG/M |
3300015319|Ga0182130_1133313 | Not Available | 508 | Open in IMG/M |
3300015326|Ga0182166_1103005 | Not Available | 575 | Open in IMG/M |
3300015326|Ga0182166_1129212 | Not Available | 527 | Open in IMG/M |
3300015327|Ga0182114_1162140 | Not Available | 501 | Open in IMG/M |
3300015330|Ga0182152_1046597 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 792 | Open in IMG/M |
3300015332|Ga0182117_1089364 | Not Available | 660 | Open in IMG/M |
3300015333|Ga0182147_1046743 | Not Available | 829 | Open in IMG/M |
3300015333|Ga0182147_1108801 | Not Available | 605 | Open in IMG/M |
3300015334|Ga0182132_1042816 | Not Available | 858 | Open in IMG/M |
3300015335|Ga0182116_1074164 | Not Available | 730 | Open in IMG/M |
3300015335|Ga0182116_1162123 | Not Available | 527 | Open in IMG/M |
3300015335|Ga0182116_1166021 | Not Available | 521 | Open in IMG/M |
3300015338|Ga0182137_1068582 | Not Available | 751 | Open in IMG/M |
3300015339|Ga0182149_1091368 | Not Available | 657 | Open in IMG/M |
3300015348|Ga0182115_1237144 | Not Available | 581 | Open in IMG/M |
3300015349|Ga0182185_1162101 | Not Available | 669 | Open in IMG/M |
3300015350|Ga0182163_1145975 | Not Available | 734 | Open in IMG/M |
3300015350|Ga0182163_1151028 | Not Available | 722 | Open in IMG/M |
3300015350|Ga0182163_1172000 | Not Available | 676 | Open in IMG/M |
3300015350|Ga0182163_1222826 | Not Available | 591 | Open in IMG/M |
3300015350|Ga0182163_1259110 | Not Available | 545 | Open in IMG/M |
3300015352|Ga0182169_1141234 | Not Available | 783 | Open in IMG/M |
3300015352|Ga0182169_1149630 | Not Available | 761 | Open in IMG/M |
3300015352|Ga0182169_1154032 | Not Available | 750 | Open in IMG/M |
3300015352|Ga0182169_1254820 | Not Available | 570 | Open in IMG/M |
3300015353|Ga0182179_1050967 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1130 | Open in IMG/M |
3300015353|Ga0182179_1054400 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1102 | Open in IMG/M |
3300015353|Ga0182179_1199750 | Not Available | 636 | Open in IMG/M |
3300017408|Ga0182197_1071823 | Not Available | 668 | Open in IMG/M |
3300017412|Ga0182199_1189122 | Not Available | 519 | Open in IMG/M |
3300017414|Ga0182195_1166113 | Not Available | 567 | Open in IMG/M |
3300017414|Ga0182195_1195434 | Not Available | 530 | Open in IMG/M |
3300017421|Ga0182213_1116165 | Not Available | 746 | Open in IMG/M |
3300017422|Ga0182201_1014451 | Not Available | 1063 | Open in IMG/M |
3300017422|Ga0182201_1141138 | Not Available | 507 | Open in IMG/M |
3300017422|Ga0182201_1141956 | Not Available | 506 | Open in IMG/M |
3300017432|Ga0182196_1114641 | Not Available | 561 | Open in IMG/M |
3300017439|Ga0182200_1140809 | Not Available | 531 | Open in IMG/M |
3300017446|Ga0182217_1078842 | Not Available | 769 | Open in IMG/M |
3300017692|Ga0182210_1153284 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 513 | Open in IMG/M |
3300020023|Ga0182178_1014802 | Not Available | 585 | Open in IMG/M |
3300020033|Ga0182146_103468 | Not Available | 618 | Open in IMG/M |
3300020223|Ga0182118_101074 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1068 | Open in IMG/M |
3300022465|Ga0213505_110347 | Not Available | 780 | Open in IMG/M |
3300025315|Ga0207697_10094596 | Not Available | 1268 | Open in IMG/M |
3300025517|Ga0207869_1028562 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 798 | Open in IMG/M |
3300025529|Ga0207865_126837 | Not Available | 757 | Open in IMG/M |
3300025711|Ga0207696_1058572 | Not Available | 1087 | Open in IMG/M |
3300025900|Ga0207710_10431712 | Not Available | 679 | Open in IMG/M |
3300025910|Ga0207684_11003764 | Not Available | 698 | Open in IMG/M |
3300025922|Ga0207646_10567081 | Not Available | 1020 | Open in IMG/M |
3300025931|Ga0207644_10700302 | Not Available | 845 | Open in IMG/M |
3300025931|Ga0207644_11826320 | Not Available | 508 | Open in IMG/M |
3300025941|Ga0207711_11650597 | Not Available | 584 | Open in IMG/M |
3300025961|Ga0207712_11176392 | Not Available | 684 | Open in IMG/M |
3300026088|Ga0207641_10688123 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1006 | Open in IMG/M |
3300028049|Ga0268322_1008088 | Not Available | 917 | Open in IMG/M |
3300028050|Ga0268328_1017831 | Not Available | 810 | Open in IMG/M |
3300028050|Ga0268328_1037944 | Not Available | 634 | Open in IMG/M |
3300028053|Ga0268346_1043698 | Not Available | 506 | Open in IMG/M |
3300028054|Ga0268306_1003820 | Not Available | 985 | Open in IMG/M |
3300028056|Ga0268330_1022964 | Not Available | 716 | Open in IMG/M |
3300028058|Ga0268332_1016413 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 860 | Open in IMG/M |
3300028058|Ga0268332_1021773 | Not Available | 789 | Open in IMG/M |
3300028058|Ga0268332_1028581 | Not Available | 724 | Open in IMG/M |
3300028061|Ga0268314_1016641 | Not Available | 759 | Open in IMG/M |
3300028061|Ga0268314_1021096 | Not Available | 701 | Open in IMG/M |
3300028064|Ga0268340_1015362 | Not Available | 902 | Open in IMG/M |
3300028140|Ga0268334_1006288 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 725 | Open in IMG/M |
3300028142|Ga0268347_1010905 | Not Available | 717 | Open in IMG/M |
3300028142|Ga0268347_1034720 | Not Available | 503 | Open in IMG/M |
3300028150|Ga0268343_1018043 | Not Available | 522 | Open in IMG/M |
3300028154|Ga0268341_1026919 | Not Available | 531 | Open in IMG/M |
3300028251|Ga0268324_1000796 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1377 | Open in IMG/M |
3300028253|Ga0268316_1015969 | Not Available | 578 | Open in IMG/M |
3300028256|Ga0268304_1007524 | Not Available | 631 | Open in IMG/M |
3300028262|Ga0268310_1039466 | Not Available | 554 | Open in IMG/M |
3300028467|Ga0268333_1013837 | Not Available | 511 | Open in IMG/M |
3300028469|Ga0268337_1007456 | Not Available | 669 | Open in IMG/M |
3300028475|Ga0268327_1009742 | Not Available | 684 | Open in IMG/M |
3300028476|Ga0268329_1001185 | Not Available | 1214 | Open in IMG/M |
3300028527|Ga0268335_1018280 | Not Available | 508 | Open in IMG/M |
3300032465|Ga0214493_1000699 | Not Available | 3846 | Open in IMG/M |
3300032465|Ga0214493_1149379 | Not Available | 542 | Open in IMG/M |
3300032467|Ga0214488_1070381 | Not Available | 774 | Open in IMG/M |
3300032468|Ga0214482_1006423 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1806 | Open in IMG/M |
3300032468|Ga0214482_1052499 | Not Available | 788 | Open in IMG/M |
3300032469|Ga0214491_1033820 | Not Available | 1198 | Open in IMG/M |
3300032490|Ga0214495_1114696 | Not Available | 613 | Open in IMG/M |
3300032550|Ga0321340_1047506 | Not Available | 598 | Open in IMG/M |
3300032589|Ga0214500_1132905 | Not Available | 709 | Open in IMG/M |
3300032590|Ga0214489_1009031 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1343 | Open in IMG/M |
3300032591|Ga0214484_1072468 | Not Available | 725 | Open in IMG/M |
3300032593|Ga0321338_1187486 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 742 | Open in IMG/M |
3300032689|Ga0214497_1039112 | Not Available | 1038 | Open in IMG/M |
3300032698|Ga0214485_1057254 | Not Available | 749 | Open in IMG/M |
3300032758|Ga0314746_1035104 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1135 | Open in IMG/M |
3300032759|Ga0314720_1045237 | Not Available | 527 | Open in IMG/M |
3300032789|Ga0314725_1000730 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2545 | Open in IMG/M |
3300032789|Ga0314725_1029215 | Not Available | 669 | Open in IMG/M |
3300032812|Ga0314745_1121593 | Not Available | 532 | Open in IMG/M |
3300032844|Ga0314743_1155017 | Not Available | 502 | Open in IMG/M |
3300032845|Ga0314727_1025777 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 821 | Open in IMG/M |
3300032875|Ga0314737_1006754 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1659 | Open in IMG/M |
3300032889|Ga0314751_1093497 | Not Available | 607 | Open in IMG/M |
3300032916|Ga0314734_1108083 | Not Available | 543 | Open in IMG/M |
3300032966|Ga0314722_1059113 | Not Available | 602 | Open in IMG/M |
3300032970|Ga0314716_121135 | Not Available | 767 | Open in IMG/M |
3300033530|Ga0314760_1070678 | Not Available | 865 | Open in IMG/M |
3300033532|Ga0314767_1159100 | Not Available | 567 | Open in IMG/M |
3300033535|Ga0314759_1292134 | Not Available | 515 | Open in IMG/M |
3300033537|Ga0314766_1269882 | Not Available | 614 | Open in IMG/M |
3300033537|Ga0314766_1297477 | Not Available | 581 | Open in IMG/M |
3300033542|Ga0314769_1315841 | Not Available | 524 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 56.14% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 15.20% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 5.26% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.51% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.34% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.92% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.75% |
Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 1.17% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
Switchgrass Leaf | Host-Associated → Plants → Phylloplane → Endophytes → Unclassified → Switchgrass Leaf | 0.58% |
Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
3300009985 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_101 metaG | Host-Associated | Open in IMG/M |
3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012949 | Switchgrass enrichment cultures co-assembly | Engineered | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300022465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025517 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-5-D (SPAdes) | Engineered | Open in IMG/M |
3300025529 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-4-D (SPAdes) | Engineered | Open in IMG/M |
3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032468 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032550 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032759 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032789 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032845 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032875 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032889 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032966 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032970 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033537 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033542 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070690_1006547792 | 3300005330 | Switchgrass Rhizosphere | IYLITLIELFVHIDREKHSLRVLTPRETTKDKLANLLVSKSQAIE* |
Ga0070668_1012401501 | 3300005347 | Switchgrass Rhizosphere | MHESIIYLITLIELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG* |
Ga0070669_1012923762 | 3300005353 | Switchgrass Rhizosphere | TLIELFVHIYHEKHPLRVLIQRETTKDKLENMLASKSQAIG* |
Ga0070669_1015647301 | 3300005353 | Switchgrass Rhizosphere | MAQYARCTNYLITLVELFVHIDREKHSLRVFTPRETTKDKL |
Ga0070671_1004654131 | 3300005355 | Switchgrass Rhizosphere | AFKFNKAWLNLHESTIYLTTLIELFVHIDHEKHSLRVLTPRETTKDKLANLLVSKSQAIE |
Ga0070671_1005764971 | 3300005355 | Switchgrass Rhizosphere | LHESTIYLTTLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIK* |
Ga0070667_1015694141 | 3300005367 | Switchgrass Rhizosphere | MHESTIYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANMLVSKSQTIK* |
Ga0070701_106022861 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ESTIYLTTLIELFVHIDREKQSLRVLTPRETTKDKLANLLVSKSQAIE* |
Ga0070708_1010203951 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MHESTIYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANMLVSKSQAIK* |
Ga0070686_1013656271 | 3300005544 | Switchgrass Rhizosphere | LHESTIYLITLIELFVHIDHEKHSLRVLTPRETTKDKLANLLVSKSQAIE* |
Ga0070686_1018125961 | 3300005544 | Switchgrass Rhizosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLVNMLVSKSQAIG* |
Ga0068859_1008338825 | 3300005617 | Switchgrass Rhizosphere | MHESTNYLITLIELFVHNDREKHSLRVLTPRETTKDKLA |
Ga0068864_1017337791 | 3300005618 | Switchgrass Rhizosphere | MHESTIYLTTLIELFVHIDCEKHSLRVLTLRETTKDKLANMLVSKSQTIE* |
Ga0068864_1018724662 | 3300005618 | Switchgrass Rhizosphere | FNRAWLNMHESTIYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANMLVSKSQAIK* |
Ga0068863_1007900023 | 3300005841 | Switchgrass Rhizosphere | MTQYA*STIYLITLVELFIHIDREKHSLRVLTPRETTKDKLENMLVS |
Ga0068863_1014750502 | 3300005841 | Switchgrass Rhizosphere | MHESIIYLTTLRELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG* |
Ga0105251_104066001 | 3300009011 | Switchgrass Rhizosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIK* |
Ga0105250_102436182 | 3300009092 | Switchgrass Rhizosphere | MYESTIYLTTLRELFVHIDREKHSLRVLTPHETTKDKLENMLVSKSQTIG* |
Ga0105250_105091701 | 3300009092 | Switchgrass Rhizosphere | MHESTIYLSTLIELFVHIDREKHSLRVLTPRETTKD |
Ga0105137_1011721 | 3300009972 | Switchgrass Associated | MHEGTIYLTTLIELFVHIDCEKHSLRVLTSRETTKDKLANMLVSKSQAIK* |
Ga0105128_1042091 | 3300009976 | Switchgrass Associated | MLESTPFYLITLLQLFVHIDREKYSLTVLTPRETTKDKLENMLVSKSQAIE* |
Ga0105135_1284261 | 3300009980 | Switchgrass Associated | MHESTIYLTTIRELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG* |
Ga0105036_1101061 | 3300009985 | Switchgrass Leaf | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIE* |
Ga0105131_1114152 | 3300009989 | Switchgrass Associated | MHESTIYLITLIEMFVHIYREKHSLRVLTPRETTKDKLANMLV |
Ga0105132_1296381 | 3300009990 | Switchgrass Associated | AFKFNRTWINMHESTIYLITLIELFVHIDREKHSLKVLTPRETTKDRLANMLVSKSQAIG |
Ga0105120_10063282 | 3300009992 | Switchgrass Associated | MTQYA*STIYLITLVELFIHIDREKHSLRVLTPRETTKDKLENMLVSKI |
Ga0105126_10096151 | 3300009994 | Switchgrass Associated | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQTIE* |
Ga0105126_10387931 | 3300009994 | Switchgrass Associated | MHESTIYLITLIELFVHIDHEKHPLRVLTPRETTKVKLENMLVSKSQAIG* |
Ga0105126_10404751 | 3300009994 | Switchgrass Associated | MHESTIYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLATC* |
Ga0134125_113340541 | 3300010371 | Terrestrial Soil | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLENMLVSKITTYRMNSP* |
Ga0134128_114423691 | 3300010373 | Terrestrial Soil | MHESAKYLTTLIELFVHIDCEKHFFRVLIPRETTNDKLENMLVSKITIHRMSSP* |
Ga0134127_107532101 | 3300010399 | Terrestrial Soil | MHEGTIYLTTLRELFVHIDREKHSLRVLTPSETTKDKLVNS |
Ga0134127_119250281 | 3300010399 | Terrestrial Soil | MHESTLLYLITLIELLIHIDCEKHSLRVLTPRETTKDKLANMLASKSQTIE* |
Ga0134122_128159142 | 3300010400 | Terrestrial Soil | MHESIIYLTTLRELFVHIDREKHSLRVLTPCETTKDKLVNMLVSKLQAIG* |
Ga0153798_102750661 | 3300012949 | Switchgrass Degrading | MHESTKYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANKLVSKSQAIE* |
Ga0163162_121065841 | 3300013306 | Switchgrass Rhizosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIK* |
Ga0157379_119292501 | 3300014968 | Switchgrass Rhizosphere | MHESTIYLTTLRELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG* |
Ga0182100_10109621 | 3300015280 | Switchgrass Phyllosphere | MHESTIYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANTLVSKSQAIK* |
Ga0182101_10298661 | 3300015284 | Switchgrass Phyllosphere | MHESTIYLTTLRELFVHIDREKHSLRVLTPRETTKDKLENVLVSKSQTIG* |
Ga0182105_11008461 | 3300015290 | Switchgrass Phyllosphere | QESTIYLITILELFVHIYREKHSLRVLTPCETTKDKLANMLVSKSQPIG* |
Ga0182103_10082581 | 3300015293 | Switchgrass Phyllosphere | MHESTLIYLITLIELLIHIKGERPSLRVFYFVETTKDNLANILVSKITNDRMNSP* |
Ga0182103_10342511 | 3300015293 | Switchgrass Phyllosphere | TLRELFVHIDREKHSLRVLTPCETTKDKLENMLVSKSQAIG* |
Ga0182103_10855391 | 3300015293 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSK |
Ga0182104_10288901 | 3300015297 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPHETTKDKLANMLVSKSQAK* |
Ga0182104_10563871 | 3300015297 | Switchgrass Phyllosphere | MHESTKYLTTLTELFVHIDREKHSLRVLTPRETTKYKLVDM |
Ga0182104_10996061 | 3300015297 | Switchgrass Phyllosphere | MHEGTIYLTTLIELFVHIDCEKHSLRVLTSRETTKDKLAN |
Ga0182184_10701331 | 3300015301 | Switchgrass Phyllosphere | MHENTIYLIILIELFVHIDREKHSLRVLTQCETIKNKL |
Ga0182180_10397352 | 3300015306 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDCGKHSLRVLTPRETTKDKLENTLVSK |
Ga0182098_10328041 | 3300015309 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDHEKYPLRVLTLSETTKDKLENILVSKSQAIG* |
Ga0182098_10597441 | 3300015309 | Switchgrass Phyllosphere | ITLIELFVHIDREKHSLRVLIPRETTKDKLANMLVSKSQPIG* |
Ga0182098_10713061 | 3300015309 | Switchgrass Phyllosphere | MHEGTIYLTTLIELFVHIGCEKHSLRVLTSRETTKDKLANMLVSKSQAIK* |
Ga0182162_11187041 | 3300015310 | Switchgrass Phyllosphere | MHESTINLITLIELFVHIDREKHSLRVLTPRETTKDK |
Ga0182182_10361272 | 3300015311 | Switchgrass Phyllosphere | MHISTIYLLTLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIG* |
Ga0182182_10797901 | 3300015311 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPCETTKDKLENMLVSKSQPIG* |
Ga0182168_10921561 | 3300015312 | Switchgrass Phyllosphere | MHESTNYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANMLVSK |
Ga0182120_10424232 | 3300015315 | Switchgrass Phyllosphere | MHESTNYLITLIELFVHIDCGKHSLRVLTPRETTKDKLENTLVSKSQAIG* |
Ga0182130_10769001 | 3300015319 | Switchgrass Phyllosphere | MYESTIYLTTLRELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG* |
Ga0182130_11333132 | 3300015319 | Switchgrass Phyllosphere | FNKAWLNMHESTNYLTTLIELFVHIDCEKYSLRVLTPRETTKDKLANLLVSKSQTIE* |
Ga0182166_11030051 | 3300015326 | Switchgrass Phyllosphere | MHESTNHLTTLIELFVHIDRGKHSLRVLTPRETTKDKHANMLASKSQAIK* |
Ga0182166_11292121 | 3300015326 | Switchgrass Phyllosphere | LHESTIYLTTLIELFVHIDHEKHSLRVLTPRETTKD |
Ga0182114_11621401 | 3300015327 | Switchgrass Phyllosphere | MHESIIYLTTLIELFVHIDCEKHSLRVLTPRETTKDK |
Ga0182152_10465971 | 3300015330 | Switchgrass Phyllosphere | FNRAWLNMHESTNYLTTLIELFVHIDCEKHSLRVLTPCETTKDKLANMLVSKSQAIK* |
Ga0182117_10893641 | 3300015332 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDHEKHSLRVLTPRETTKDKLANLLVSKSQAIE* |
Ga0182147_10467431 | 3300015333 | Switchgrass Phyllosphere | MHESTIYLITLIEMFVHIYREKHSLRVLTPRETTKDKLANMLVSKSQAIG* |
Ga0182147_11088011 | 3300015333 | Switchgrass Phyllosphere | MHESTKYLITLMELFVHINSEKHSLRVLTPCETTKDKLANMLV |
Ga0182132_10428161 | 3300015334 | Switchgrass Phyllosphere | MHESTIYLTTLRELFVHIDCEKHSLRVLTPREITKDKLENMLVSKSQTIE* |
Ga0182116_10741641 | 3300015335 | Switchgrass Phyllosphere | MHESTIYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANMLVSKSQATK* |
Ga0182116_11621231 | 3300015335 | Switchgrass Phyllosphere | MHESTLIYLITLIELFVHIDREKHSFTVLTLRETTKDKLANMLVSK |
Ga0182116_11660211 | 3300015335 | Switchgrass Phyllosphere | MHENIIYLITLIELFVHIDREKHSLRVLTPRETTKDKLA |
Ga0182137_10685821 | 3300015338 | Switchgrass Phyllosphere | MHEGTIFLTTLIELFVHIDCEKHSLRVLTSRETTKDKLANMLVSKSQAIK* |
Ga0182149_10913681 | 3300015339 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHTEHEKHSLRVLTPCETTKDKLENMLVSKSQPIG* |
Ga0182115_12371441 | 3300015348 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDREKYSLRVLTPRETTKDELANMLVSKS |
Ga0182185_11621011 | 3300015349 | Switchgrass Phyllosphere | MHESTINLITLIELFVHIDREKHSLIVLTPCETTKDKLVNMLVSKSQPIG* |
Ga0182163_11459751 | 3300015350 | Switchgrass Phyllosphere | MHESTNYLITLIELFVHNDREKHSLRVLTPRETTKDKLENMLVSKSQATG |
Ga0182163_11510281 | 3300015350 | Switchgrass Phyllosphere | MHESTIYLTTLIELFVHIDREKHSLRVLTPRETIKDKLANMLVSKSQAIE* |
Ga0182163_11720002 | 3300015350 | Switchgrass Phyllosphere | MHESTIYLITLKEFFVHIDREKHSLRVLTPRETTKDK |
Ga0182163_12228262 | 3300015350 | Switchgrass Phyllosphere | MHEGTVYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANMLVSKSQTIE* |
Ga0182163_12591101 | 3300015350 | Switchgrass Phyllosphere | LNMHESTIYLITLRELFVHIDRGKHSLRVLTPRETTKDKLESMLVSKSQVIE* |
Ga0182169_11412341 | 3300015352 | Switchgrass Phyllosphere | MHESIIYLITLRELFVHIDHGKYSLRVLTLRETTKDKLTNMLVSK* |
Ga0182169_11496301 | 3300015352 | Switchgrass Phyllosphere | HESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG* |
Ga0182169_11540321 | 3300015352 | Switchgrass Phyllosphere | MHENTIYLITLIELFVHIDREKHSLRVLTPCETTKDKLVNMLVSKSQAIG* |
Ga0182169_12548201 | 3300015352 | Switchgrass Phyllosphere | MHESTLLYLITLIELLIHIERKQHSLRVLISRDTTKDKLPNMLVSKSQPIG* |
Ga0182179_10509672 | 3300015353 | Switchgrass Phyllosphere | FKFNRAWLNMHESTINLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIG* |
Ga0182179_10544001 | 3300015353 | Switchgrass Phyllosphere | AFKFNRAWLNMHESTINLITLIELFVHIDREKHSLIVLTPCETTKDKLVNMLVSKSQPIG |
Ga0182179_11997502 | 3300015353 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDREKHSLKVLTPRETTKDKLA |
Ga0182197_10718231 | 3300017408 | Switchgrass Phyllosphere | MHESIIYLITLIELFVHIAREKHYLRVLTPRETTKDKLANMLVSKSQPIG |
Ga0182199_11891221 | 3300017412 | Switchgrass Phyllosphere | MYEHIAYELRYEHFKFNRAWLNKYESTIYLTTLRELFVHIDCEKHSLRVLTPRETTKDKLANMLVSKSQAIE |
Ga0182195_11661131 | 3300017414 | Switchgrass Phyllosphere | WLNMHESTINLITLIELFVHIDREKHSLIVLTPCETTKDKLVNMLVSKSQPIG |
Ga0182195_11954341 | 3300017414 | Switchgrass Phyllosphere | MHVSTIYLITLIELFVHINCEKHSLRVLTPRETTK |
Ga0182213_11161651 | 3300017421 | Switchgrass Phyllosphere | MHESTIYLTTLIELFVHIDCEKHSLRVLTPGETTKDKLANMLVSKSQAIK |
Ga0182201_10144511 | 3300017422 | Switchgrass Phyllosphere | MHESIIYLTTLRELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG |
Ga0182201_11411381 | 3300017422 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPHETTKDKLANILVSKSQPIG |
Ga0182201_11419561 | 3300017422 | Switchgrass Phyllosphere | MHEGTVYLTTLIELFVHIDCEKHSLRVLTPRDTTKDKLANMLVSKSQTIE |
Ga0182196_11146411 | 3300017432 | Switchgrass Phyllosphere | NMHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIE |
Ga0182200_11408092 | 3300017439 | Switchgrass Phyllosphere | MYESIIYLITLIELFIHINREKHSLRVLTPREITKDKLANMLVSKSQPIG |
Ga0182217_10788421 | 3300017446 | Switchgrass Phyllosphere | MHESTINLITLRELFVHIDREKHSLRVLTPSETTKDKLVDMLVSKS |
Ga0182210_11532841 | 3300017692 | Switchgrass Phyllosphere | MHESIIYLITLIELFVHIDHEKHPLRELTPRETTKDKLANMLVSKSQAIG |
Ga0182178_10148021 | 3300020023 | Switchgrass Phyllosphere | MHESTNYLTTLIELFVHIDCEKHSLRVLTPCETTKDKLANMLVSKSQATK |
Ga0182146_1034681 | 3300020033 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLANILVSKSQAIG |
Ga0182118_1010742 | 3300020223 | Switchgrass Phyllosphere | YLITLIELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG |
Ga0213505_1103471 | 3300022465 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDREKHYLRVLTPRETTKDKLANMLV |
Ga0207697_100945962 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKITNHRMNSP |
Ga0207869_10285621 | 3300025517 | Ionic Liquid And High Solid Enriched | FNKAWLNMHEGTIYLTTLIELFVHIDCEKHSLRVLTSRETTKDKLANMLVSKSQAIK |
Ga0207865_1268371 | 3300025529 | Ionic Liquid And High Solid Enriched | MHEGTIYLTTLIELFVHIDCEKHSLRVLTSRETTKDKLANMLVSKSQTIE |
Ga0207696_10585721 | 3300025711 | Switchgrass Rhizosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLVNMLVSKSQTIG |
Ga0207710_104317121 | 3300025900 | Switchgrass Rhizosphere | MHESTIYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANMLVSKSQAIE |
Ga0207684_110037641 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIG |
Ga0207646_105670812 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MHESTIYLTTLIELFVHIDCEKHSLRVLTLRETTKDKLANMLVSKSQAIK |
Ga0207644_107003021 | 3300025931 | Switchgrass Rhizosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIK |
Ga0207644_118263201 | 3300025931 | Switchgrass Rhizosphere | MHESTNYLTTLIELFVHIDCEKHSLRVLTPGETTKDKLANML |
Ga0207711_116505971 | 3300025941 | Switchgrass Rhizosphere | MDESIIYLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIK |
Ga0207712_111763921 | 3300025961 | Switchgrass Rhizosphere | MHESTIYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANMLVSKSQAIK |
Ga0207641_106881232 | 3300026088 | Switchgrass Rhizosphere | KAWLNLHESTIYLTTLIELFVHIDREKHSLRVLTPRETTKDKLANLLVSKSQAIE |
Ga0268322_10080881 | 3300028049 | Phyllosphere | MHESTIYLTTLRELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG |
Ga0268328_10178312 | 3300028050 | Phyllosphere | MHESTINLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIG |
Ga0268328_10379441 | 3300028050 | Phyllosphere | MHESTIYLTTLIELFVHIDCEKHSLRVLTPRETTK |
Ga0268346_10436981 | 3300028053 | Phyllosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPCETTKDKLANMLVSKSQTIG |
Ga0268306_10038201 | 3300028054 | Phyllosphere | LHESTIYLTTLIELFVHIDLEKHSLRVLTPRETTKDKLA |
Ga0268330_10229642 | 3300028056 | Phyllosphere | AYELRYEHFKFNRAWLNKYESTIYLTTLRELFVHIDCEKHSLRVLTPREITKDKLENMLVSKSQAIE |
Ga0268332_10164131 | 3300028058 | Phyllosphere | YIITLIELFVHIDREKHSLRVLTPRETTKDKLANILVSKSQVIG |
Ga0268332_10217732 | 3300028058 | Phyllosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDRLANML |
Ga0268332_10285811 | 3300028058 | Phyllosphere | MYESIIYLITLIELFIHINREKHSLRVLTPREITKDKLANMLVSKSQTI |
Ga0268314_10166412 | 3300028061 | Phyllosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDK |
Ga0268314_10210961 | 3300028061 | Phyllosphere | MHESTIYLTTLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQAIE |
Ga0268340_10153621 | 3300028064 | Phyllosphere | MHESTINLITLIELFVHIDREKHSLIVLTPCETTKDKLVNMLVSKSQPIG |
Ga0268334_10062881 | 3300028140 | Phyllosphere | IAWLNMHESTIYLITLIELFVHIDHEKHSLRVLTPRETTKDKLANLLVSKSQAIE |
Ga0268347_10109051 | 3300028142 | Phyllosphere | MHEGTVYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANMLVSKSQTIE |
Ga0268347_10347201 | 3300028142 | Phyllosphere | MHESTINLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLVSKSQ |
Ga0268343_10180431 | 3300028150 | Phyllosphere | MHESTIYLITLIELFVHIDHEKHPLRVLTPRETTKDKLENMLVSKSQAIG |
Ga0268341_10269191 | 3300028154 | Phyllosphere | MHESTIYLTTLIELFVHIDCEKHSLRVLTLRETTKD |
Ga0268324_10007962 | 3300028251 | Phyllosphere | MYESTIYLTTLRELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG |
Ga0268316_10159692 | 3300028253 | Phyllosphere | FNRAWLNIHESTIYLITLIELFVHIDREKHSLRVLTPRESTKDILANMLVSKSQPIG |
Ga0268304_10075241 | 3300028256 | Phyllosphere | MHESTIYLITLLELFVHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG |
Ga0268310_10394661 | 3300028262 | Phyllosphere | LHESTIYLTTLIELFVHIDHEKHSLRVLTPRETTKDKLANL |
Ga0268333_10138371 | 3300028467 | Phyllosphere | TLIELFVHIDREKHSLRVLTPRETTKDKLANILVSKSQTIE |
Ga0268337_10074562 | 3300028469 | Phyllosphere | MHESTINLITLIELFVHIDREKHSLRVLTPRETTKDKLANMLV |
Ga0268327_10097421 | 3300028475 | Phyllosphere | MHESTIYLTTLMELFVHIDCEKHSLRVLTPRETTKDKLANMLVSKSQAIK |
Ga0268329_10011851 | 3300028476 | Phyllosphere | MHESTIYLITLIELFVHIDHEKHPLRVLTPRETTKDKLES |
Ga0268335_10182801 | 3300028527 | Phyllosphere | AWLNMHESTNYLTTLIELFVHIDCEKHSLRVLTPCETTKDKLANMLVSKSQATK |
Ga0214493_10006992 | 3300032465 | Switchgrass Phyllosphere | MHKSTINLITLIELFVHIDREKHSLIVLTPRETTKDKLVNMLVSKSQAIG |
Ga0214493_11493791 | 3300032465 | Switchgrass Phyllosphere | MHDSTIYLTTLIELFVHIDCEKHSLRVLTPRETTKGKLENMVVSKSQAI |
Ga0214488_10703812 | 3300032467 | Switchgrass Phyllosphere | MHESTIYLTTLRELFVHIDREKHSLRVLTPRETTKD |
Ga0214482_10064232 | 3300032468 | Switchgrass Phyllosphere | ESTIYLTILIELFVHIDREKHSLRVLTPHETTKDKLENSLVSKSQPIE |
Ga0214482_10524991 | 3300032468 | Switchgrass Phyllosphere | MHEGTIFLTTLIELFVHIDCEKHSLRVLTSRETTKDKLANMLVSKSQAIK |
Ga0214491_10338201 | 3300032469 | Switchgrass Phyllosphere | MHESTIYLTILIELFVHIDREKHSLRVLTPHETTKDKLENSLVSKSQPIE |
Ga0214495_11146961 | 3300032490 | Switchgrass Phyllosphere | MHDSTIYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANTLVSKSQTIK |
Ga0321340_10475061 | 3300032550 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDHEKHPLRVLTPRETTKDKLENMLVSKSQAIE |
Ga0214500_11329051 | 3300032589 | Switchgrass Phyllosphere | MHETTIYLITLIELFIHTDREKHSLRVLKPRETTKGKLVNMLVSKSQAVG |
Ga0214489_10090312 | 3300032590 | Switchgrass Phyllosphere | MHKSTINLITLIELFVHIDREKHSLIVLTPRETTKDKLVNMLVSKSQPIG |
Ga0214484_10724681 | 3300032591 | Switchgrass Phyllosphere | MHEGTIYLTTLIELFVHIDCEKHSLRVLTPRETTKDKLANMLVSKSQAIK |
Ga0321338_11874863 | 3300032593 | Switchgrass Phyllosphere | MHESTIYLITLIELFIHIDREKHSLRVLTPRETTKDKLVNMLVSKSQAIG |
Ga0214497_10391121 | 3300032689 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDNLANMLVSKSQAIE |
Ga0214485_10572541 | 3300032698 | Switchgrass Phyllosphere | MHESTIYLTTLRELFLHIDREKHSLRVLTPRETTKDKLENMLVSKSQAIG |
Ga0314746_10351042 | 3300032758 | Switchgrass Phyllosphere | MHDSTIYLTTLIELFVHIDCEKHSLRVLTPRETTKGKLENMVVSKSQA |
Ga0314720_10452371 | 3300032759 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDRDKHSLRVLTPRETTKDNLANMLVSKSQAIE |
Ga0314725_10007302 | 3300032789 | Switchgrass Phyllosphere | MHESTIYLTTLIELFVHIDREKHSLRVLTPSETTKDKLINS |
Ga0314725_10292151 | 3300032789 | Switchgrass Phyllosphere | MHESTIYLITLLELFVHIDREKHSLRVLTPRETTND |
Ga0314745_11215931 | 3300032812 | Switchgrass Phyllosphere | MHESTLFYLITLIELFVHIDCEKHNLRVLTPPETTKGKLQNMVVTKSQAK |
Ga0314743_11550171 | 3300032844 | Switchgrass Phyllosphere | LTTLIELFVHIDCEKHSFRVLTPRETTKDKLANMLVSKSQAIK |
Ga0314727_10257771 | 3300032845 | Switchgrass Phyllosphere | IYLITLIELFVHIDHEKHPLRVLTPRETTKDKLENMLVSKSQAIE |
Ga0314737_10067541 | 3300032875 | Switchgrass Phyllosphere | MHKSTINLITLIELFVHIDREKHSLIVLTPRETTKDKLVNMLVSKSQ |
Ga0314751_10934971 | 3300032889 | Switchgrass Phyllosphere | MHESTIYLTTLRELFVHIDREKHSLRVLTPRETTKDKLE |
Ga0314734_11080831 | 3300032916 | Switchgrass Phyllosphere | MHESTIYLTILIELFVHIDREKHSHRVLTPHETTKDKLENSLVSKSQPIE |
Ga0314722_10591131 | 3300032966 | Switchgrass Phyllosphere | MHESTIYLTTLRELFVHIDREKHSLRVLTPSETTKDKLENMLAQNHNL |
Ga0314716_1211352 | 3300032970 | Switchgrass Phyllosphere | MHESTKYLITLIELFVHIDREKHSLRVLTPLETTKDKLRKHVSLKL |
Ga0314760_10706781 | 3300033530 | Switchgrass Phyllosphere | MHEGTIYLTTLIELFVHIDCEKLSLRVLTPRETTKDKLADMLVSKSQTIE |
Ga0314767_11591001 | 3300033532 | Switchgrass Phyllosphere | MHESTIYIITLIELFVHINFEKHSLRVLTPRETTKDKLANMLVSKSQAIE |
Ga0314759_12921341 | 3300033535 | Switchgrass Phyllosphere | MHESTIYLITLIELFVHIDREKHSLRVLTPRETTKDKIENMLVSKSQAIG |
Ga0314766_12698821 | 3300033537 | Switchgrass Phyllosphere | MHESTIYLTILIELFVHIDREKHSLRVLTPHETTKDKLENSLV |
Ga0314766_12974772 | 3300033537 | Switchgrass Phyllosphere | MHDSTIYLTTLIELFVHIDCEKHSLRVLTQRETTK |
Ga0314769_13158411 | 3300033542 | Switchgrass Phyllosphere | MHESTIYLTTLIELFVHIDREKHSLRVLTPRETTKGKLENMVVSKSQAI |
⦗Top⦘ |