| Basic Information | |
|---|---|
| Family ID | F002974 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 516 |
| Average Sequence Length | 48 residues |
| Representative Sequence | QDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Number of Associated Samples | 166 |
| Number of Associated Scaffolds | 516 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 15.38 % |
| % of genes near scaffold ends (potentially truncated) | 18.99 % |
| % of genes from short scaffolds (< 2000 bps) | 20.16 % |
| Associated GOLD sequencing projects | 166 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (80.039 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (72.674 % of family members) |
| Environment Ontology (ENVO) | Unclassified (94.380 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (86.628 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.17% β-sheet: 0.00% Coil/Unstructured: 68.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 516 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 0.58 |
| PF13456 | RVT_3 | 0.58 |
| PF00078 | RVT_1 | 0.39 |
| PF01693 | Cauli_VI | 0.19 |
| PF06862 | UTP25 | 0.19 |
| PF00176 | SNF2-rel_dom | 0.19 |
| PF05641 | Agenet | 0.19 |
| PF04565 | RNA_pol_Rpb2_3 | 0.19 |
| PF00218 | IGPS | 0.19 |
| PF07727 | RVT_2 | 0.19 |
| PF03381 | CDC50 | 0.19 |
| PF13428 | TPR_14 | 0.19 |
| PF13086 | AAA_11 | 0.19 |
| PF00154 | RecA | 0.19 |
| PF10536 | PMD | 0.19 |
| PF02798 | GST_N | 0.19 |
| PF05694 | SBP56 | 0.19 |
| PF00071 | Ras | 0.19 |
| PF02883 | Alpha_adaptinC2 | 0.19 |
| PF00225 | Kinesin | 0.19 |
| PF11957 | efThoc1 | 0.19 |
| PF00850 | Hist_deacetyl | 0.19 |
| PF00651 | BTB | 0.19 |
| PF00013 | KH_1 | 0.19 |
| PF00847 | AP2 | 0.19 |
| PF05699 | Dimer_Tnp_hAT | 0.19 |
| PF11523 | DUF3223 | 0.19 |
| PF03501 | S10_plectin | 0.19 |
| COG ID | Name | Functional Category | % Frequency in 516 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.33 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.39 |
| COG0085 | DNA-directed RNA polymerase, beta subunit/140 kD subunit | Transcription [K] | 0.19 |
| COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 0.19 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.19 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 80.04 % |
| All Organisms | root | All Organisms | 19.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005841|Ga0068863_102230256 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 557 | Open in IMG/M |
| 3300009995|Ga0105139_1059458 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 689 | Open in IMG/M |
| 3300010399|Ga0134127_11462069 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 755 | Open in IMG/M |
| 3300010413|Ga0136851_11935511 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 563 | Open in IMG/M |
| 3300012212|Ga0150985_113275078 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 542 | Open in IMG/M |
| 3300013297|Ga0157378_12042381 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 623 | Open in IMG/M |
| 3300015267|Ga0182122_1052837 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 551 | Open in IMG/M |
| 3300015268|Ga0182154_1055300 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 547 | Open in IMG/M |
| 3300015269|Ga0182113_1084434 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 526 | Open in IMG/M |
| 3300015270|Ga0182183_1073915 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 547 | Open in IMG/M |
| 3300015278|Ga0182099_1025139 | Not Available | 679 | Open in IMG/M |
| 3300015282|Ga0182124_1034287 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 646 | Open in IMG/M |
| 3300015285|Ga0182186_1012377 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 866 | Open in IMG/M |
| 3300015286|Ga0182176_1051291 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 592 | Open in IMG/M |
| 3300015286|Ga0182176_1085888 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 500 | Open in IMG/M |
| 3300015287|Ga0182171_1005706 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1070 | Open in IMG/M |
| 3300015288|Ga0182173_1004392 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1139 | Open in IMG/M |
| 3300015293|Ga0182103_1030795 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 739 | Open in IMG/M |
| 3300015296|Ga0182157_1070789 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 565 | Open in IMG/M |
| 3300015298|Ga0182106_1009159 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1018 | Open in IMG/M |
| 3300015299|Ga0182107_1038354 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 680 | Open in IMG/M |
| 3300015303|Ga0182123_1056353 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 593 | Open in IMG/M |
| 3300015303|Ga0182123_1096139 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 507 | Open in IMG/M |
| 3300015305|Ga0182158_1040283 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 668 | Open in IMG/M |
| 3300015305|Ga0182158_1081589 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 543 | Open in IMG/M |
| 3300015306|Ga0182180_1069342 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 563 | Open in IMG/M |
| 3300015312|Ga0182168_1112647 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 544 | Open in IMG/M |
| 3300015313|Ga0182164_1090173 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 593 | Open in IMG/M |
| 3300015314|Ga0182140_1116539 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 501 | Open in IMG/M |
| 3300015319|Ga0182130_1058775 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 684 | Open in IMG/M |
| 3300015321|Ga0182127_1059770 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 634 | Open in IMG/M |
| 3300015326|Ga0182166_1015140 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 1065 | Open in IMG/M |
| 3300015326|Ga0182166_1079288 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 633 | Open in IMG/M |
| 3300015326|Ga0182166_1093563 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 596 | Open in IMG/M |
| 3300015327|Ga0182114_1005199 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1563 | Open in IMG/M |
| 3300015330|Ga0182152_1080602 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 651 | Open in IMG/M |
| 3300015331|Ga0182131_1113883 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 572 | Open in IMG/M |
| 3300015338|Ga0182137_1116563 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 607 | Open in IMG/M |
| 3300015339|Ga0182149_1081128 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 687 | Open in IMG/M |
| 3300015341|Ga0182187_1029746 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 968 | Open in IMG/M |
| 3300015341|Ga0182187_1031485 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 951 | Open in IMG/M |
| 3300015341|Ga0182187_1154001 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 554 | Open in IMG/M |
| 3300015342|Ga0182109_1007007 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1612 | Open in IMG/M |
| 3300015343|Ga0182155_1036383 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 953 | Open in IMG/M |
| 3300015343|Ga0182155_1061394 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 800 | Open in IMG/M |
| 3300015344|Ga0182189_1097464 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 691 | Open in IMG/M |
| 3300015344|Ga0182189_1208197 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 521 | Open in IMG/M |
| 3300015345|Ga0182111_1029908 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 1086 | Open in IMG/M |
| 3300015345|Ga0182111_1082930 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 758 | Open in IMG/M |
| 3300015345|Ga0182111_1139640 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 625 | Open in IMG/M |
| 3300015347|Ga0182177_1164001 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 591 | Open in IMG/M |
| 3300015348|Ga0182115_1026491 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1541 | Open in IMG/M |
| 3300015348|Ga0182115_1039743 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 1332 | Open in IMG/M |
| 3300015348|Ga0182115_1080155 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1005 | Open in IMG/M |
| 3300015348|Ga0182115_1110588 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 868 | Open in IMG/M |
| 3300015348|Ga0182115_1166936 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 706 | Open in IMG/M |
| 3300015348|Ga0182115_1193670 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 652 | Open in IMG/M |
| 3300015349|Ga0182185_1230566 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 562 | Open in IMG/M |
| 3300015350|Ga0182163_1025997 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1493 | Open in IMG/M |
| 3300015351|Ga0182161_1008670 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1698 | Open in IMG/M |
| 3300015351|Ga0182161_1012442 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1524 | Open in IMG/M |
| 3300015351|Ga0182161_1160060 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 618 | Open in IMG/M |
| 3300015352|Ga0182169_1077118 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1043 | Open in IMG/M |
| 3300015354|Ga0182167_1019485 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1998 | Open in IMG/M |
| 3300015354|Ga0182167_1084521 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 1146 | Open in IMG/M |
| 3300015355|Ga0182159_1110680 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 823 | Open in IMG/M |
| 3300015355|Ga0182159_1176116 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 679 | Open in IMG/M |
| 3300015355|Ga0182159_1266674 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 567 | Open in IMG/M |
| 3300017404|Ga0182203_1112962 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 569 | Open in IMG/M |
| 3300017410|Ga0182207_1148019 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 534 | Open in IMG/M |
| 3300017410|Ga0182207_1149839 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae | 532 | Open in IMG/M |
| 3300017415|Ga0182202_1005056 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1359 | Open in IMG/M |
| 3300017415|Ga0182202_1005886 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 1306 | Open in IMG/M |
| 3300017421|Ga0182213_1165126 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 626 | Open in IMG/M |
| 3300017425|Ga0182224_1120225 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 559 | Open in IMG/M |
| 3300017427|Ga0182190_1035945 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 840 | Open in IMG/M |
| 3300017427|Ga0182190_1065459 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 689 | Open in IMG/M |
| 3300017430|Ga0182192_1026840 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 947 | Open in IMG/M |
| 3300017436|Ga0182209_1071309 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 670 | Open in IMG/M |
| 3300017442|Ga0182221_1004754 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1477 | Open in IMG/M |
| 3300017442|Ga0182221_1085656 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 623 | Open in IMG/M |
| 3300017443|Ga0182193_1145323 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 560 | Open in IMG/M |
| 3300017683|Ga0182218_1022459 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 894 | Open in IMG/M |
| 3300017683|Ga0182218_1053975 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 692 | Open in IMG/M |
| 3300017683|Ga0182218_1074152 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 630 | Open in IMG/M |
| 3300017685|Ga0182227_1041378 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 807 | Open in IMG/M |
| 3300017685|Ga0182227_1084792 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 601 | Open in IMG/M |
| 3300017690|Ga0182223_1112240 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 517 | Open in IMG/M |
| 3300017693|Ga0182216_1080084 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 754 | Open in IMG/M |
| 3300020077|Ga0206351_10532046 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 910 | Open in IMG/M |
| 3300031058|Ga0308189_10482676 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 531 | Open in IMG/M |
| 3300032465|Ga0214493_1145680 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 550 | Open in IMG/M |
| 3300032548|Ga0214483_1086155 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 511 | Open in IMG/M |
| 3300032551|Ga0321339_1150449 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 511 | Open in IMG/M |
| 3300032589|Ga0214500_1076007 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 946 | Open in IMG/M |
| 3300032590|Ga0214489_1041271 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 693 | Open in IMG/M |
| 3300032592|Ga0214504_1105488 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 548 | Open in IMG/M |
| 3300032689|Ga0214497_1071573 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 768 | Open in IMG/M |
| 3300032812|Ga0314745_1041282 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 990 | Open in IMG/M |
| 3300032812|Ga0314745_1058748 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 826 | Open in IMG/M |
| 3300032844|Ga0314743_1128277 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 569 | Open in IMG/M |
| 3300033525|Ga0314758_1090481 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 854 | Open in IMG/M |
| 3300033532|Ga0314767_1183182 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 526 | Open in IMG/M |
| 3300033542|Ga0314769_1247582 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 598 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 72.67% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 18.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 1.36% |
| Fungus Garden | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden | 0.78% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.39% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.39% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 0.39% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.19% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.19% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.19% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.19% |
| Root | Host-Associated → Plants → Roots → Unclassified → Unclassified → Root | 0.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.19% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006879 | Agricultural soil microbial communities from Georgia to study Nitrogen management - Poultry litter 2014 | Environmental | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300013000 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM1 | Host-Associated | Open in IMG/M |
| 3300013022 | Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM3 | Host-Associated | Open in IMG/M |
| 3300013025 | Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM2 | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014486 | Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020071 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032468 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032548 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032550 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032592 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032759 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032791 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032826 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033291 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-10 | Environmental | Open in IMG/M |
| 3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033525 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033538 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033542 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070662_1004107502 | 3300005457 | Corn Rhizosphere | VHIGIIRRPENVKRGRGRPTLTWTEAVKRDLKEWNIDKELAADRKGWKCAIHVPEP* |
| Ga0070681_116774422 | 3300005458 | Corn Rhizosphere | HIGIIRRPENVKRGRGRPTLTWTEAVKRDLKEWNIDKELAVDRKGWKCAIHVPEP* |
| Ga0068866_104242181 | 3300005718 | Miscanthus Rhizosphere | NVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVPEP* |
| Ga0068861_1018381672 | 3300005719 | Switchgrass Rhizosphere | VKRGRGRPKLTWEEAVKRDMKDWDIVKELAMDRGAWKSAIHVSEP* |
| Ga0068863_1022302561 | 3300005841 | Switchgrass Rhizosphere | DNVKRGRGRPKLTWDESVKRDLKDWNISKEIALIGALGD* |
| Ga0079226_109571461 | 3300006879 | Agricultural Soil | RMWRGRGRPTLTWTEAVKRDLKEWNIDKELAVDRKGWKCAIHVPEP* |
| Ga0105139_10594582 | 3300009995 | Switchgrass Associated | VKRGRGRPKLTWDESVKRDLKDWNISNKIILDRSA* |
| Ga0105139_10838522 | 3300009995 | Switchgrass Associated | VKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSSWRLAINVPEP* |
| Ga0134127_114620691 | 3300010399 | Terrestrial Soil | LITVYSVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRS |
| Ga0136851_114260592 | 3300010413 | Mangrove Sediment | VHIGIIRRPKNVKRGRGRPTLTCTEAVKRDLKEWNIDKELVVDRKGWKCAIHVPEP* |
| Ga0136851_119355111 | 3300010413 | Mangrove Sediment | VIAMERGRGRPKLTGVETEKEDLKGWNITKDLALNRSA* |
| Ga0105246_111857501 | 3300011119 | Miscanthus Rhizosphere | VRSGILNQDNNVKRGRGRPKLIWVEAIKGDLKGWNISKDLALDRSPWKIAIHVPEP* |
| Ga0120192_100950801 | 3300012021 | Terrestrial | VKRGRGRPILTWEKAVKRDLKDWNIMRELALDRAAWKAAIHVPEP* |
| Ga0150985_1132750782 | 3300012212 | Avena Fatua Rhizosphere | LTWEEAIRRDLKEWNIPREMAFDRAAWKSAIHVPEP* |
| Ga0157360_11994641 | 3300013000 | Fungus Garden | MHSGIIRRNNDVKRGRGRPNLTWEEAVKRDLRDWNIVRELALDRAAWKAAIHVPEP* |
| Ga0157368_10665231 | 3300013022 | Fungus Garden | VQRRPLEAPVHSGIIRRNNDVKRGRGKPNLTWEEAVKRDLRDWNIVRELALDRAAWKAAIHVPEP* |
| Ga0157367_12019881 | 3300013025 | Fungus Garden | ACATPTKMFGHMQRKPLEAPVHSGIIRRNNDVKRGRGRPNLIWEETVKIDLKDWNITRELALDRAAWKAAIHVPEP* |
| Ga0157367_13116001 | 3300013025 | Fungus Garden | VQRRPPEAPVHNGIIRRNNGVKRGKGKPNLTWEEAVKRDLKDWNIMRELALDRVVWKAAIHVREP* |
| Ga0157378_120423811 | 3300013297 | Miscanthus Rhizosphere | MKRGRGRPKLTWVEAIKGDLKGWNISKDLALDWSAWKTAIH |
| Ga0157378_124807731 | 3300013297 | Miscanthus Rhizosphere | QDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182004_100093913 | 3300014486 | Root | VRRGRGRSKLTWGEAIKRDLKGWDWDIPRDLCLDRTALKAVIDMPEP* |
| Ga0182122_10227272 | 3300015267 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSVWKTAIHVPEP* |
| Ga0182122_10528371 | 3300015267 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNIPKDLALDRSAGKTAIHVPEP* |
| Ga0182122_10723181 | 3300015267 | Miscanthus Phyllosphere | QDSNVKRGRGRPKLTWVEAIKGDLKGWNISKDLALDTSAWKTAIHVPEL* |
| Ga0182154_10051801 | 3300015268 | Miscanthus Phyllosphere | PEAPVCSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNILKDLALDRSAWKTAIHVPEP |
| Ga0182154_10308761 | 3300015268 | Miscanthus Phyllosphere | RGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182154_10374672 | 3300015268 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPE |
| Ga0182154_10553001 | 3300015268 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSA* |
| Ga0182113_10463042 | 3300015269 | Miscanthus Phyllosphere | RGRGRPKLTWVEAIKGDLKGWNIPKDLALDRIVWKTAIHVPEP* |
| Ga0182113_10464841 | 3300015269 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWVDAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182113_10478021 | 3300015269 | Miscanthus Phyllosphere | PKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182113_10482681 | 3300015269 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182113_10487021 | 3300015269 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKNLAFDRSAWKTAIHVPEP* |
| Ga0182113_10790111 | 3300015269 | Miscanthus Phyllosphere | RGRPKLTWVETIKGDLKGWNISKDLALDRSVWKTAIHVFGP* |
| Ga0182113_10844341 | 3300015269 | Miscanthus Phyllosphere | RGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVLEP* |
| Ga0182113_10952921 | 3300015269 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVPEP* |
| Ga0182183_10739151 | 3300015270 | Switchgrass Phyllosphere | VTSDVKRGRGRPKLTWDELVKRDLKDWNISKEIALDRSA |
| Ga0182188_10035681 | 3300015274 | Miscanthus Phyllosphere | VQRRPLEAPVHSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIHNDLALNRSA* |
| Ga0182188_10058791 | 3300015274 | Miscanthus Phyllosphere | GRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182188_10117502 | 3300015274 | Miscanthus Phyllosphere | MKRGRGRPKLTWVEAIKGDLKGWNITKDLALDRTAWEIVIHVPEP* |
| Ga0182188_10351431 | 3300015274 | Miscanthus Phyllosphere | PKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182188_10520583 | 3300015274 | Miscanthus Phyllosphere | LKSGREKPKLTWIEAIKEDLKEWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182172_10094781 | 3300015275 | Miscanthus Phyllosphere | QDSNVKRGRQRSKLTWAETLKGDLKGWNIPKDLALDRSVWKIVIHMSEP* |
| Ga0182172_10197311 | 3300015275 | Miscanthus Phyllosphere | RSEILSQDSNVKRGRGRPKLTWIEAIKEDLKGCNIPKDLALDRIAWKTAIHVSEP* |
| Ga0182172_10768941 | 3300015275 | Miscanthus Phyllosphere | PPEAPVRSGILGQDSNVKKGRERPKLTWVEAIKGDLKGWNISKDLALDRNAWKTAIYVPEP* |
| Ga0182170_10206821 | 3300015276 | Miscanthus Phyllosphere | GQDSNVKKGRERPKLTWVEAIKGDLKGWNIPKDLALDRSARKTAIHVPEP* |
| Ga0182170_10414501 | 3300015276 | Miscanthus Phyllosphere | PVRSGILSQDSNVKRGRGRPKLIWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVLEP* |
| Ga0182170_10558181 | 3300015276 | Miscanthus Phyllosphere | RSGILSQDNYVKRGRGIPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVLEP* |
| Ga0182128_10200242 | 3300015277 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWVEAIKGDLKGWNISKDLALNRSAWKTAIHVPEP* |
| Ga0182128_10727661 | 3300015277 | Miscanthus Phyllosphere | EAPVRSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGCNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182099_10251391 | 3300015278 | Switchgrass Phyllosphere | VKRGRGRPNLTWEESMKRDMKDWGIAKELAMDRGAWK* |
| Ga0182174_10512191 | 3300015279 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182174_10752602 | 3300015279 | Miscanthus Phyllosphere | NVKKDRGRSKLTWIYAIKEDMKGWNIPKELALDRSAWKIAIHVPEP* |
| Ga0182100_10050603 | 3300015280 | Switchgrass Phyllosphere | MHSGIIRRNNDVKRGRGRPNLTWEEAVKRDLKDWNIMRELALDRAAWKAAIHVPEP* |
| Ga0182160_10157741 | 3300015281 | Miscanthus Phyllosphere | LSQDSNVKRGREKLKLTWVEVIKGDLKGCNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182160_10241811 | 3300015281 | Miscanthus Phyllosphere | VQRRPSEAPVRSGIRSQDSNVKRDRGRPKLTWVDAIKGNLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182160_10833831 | 3300015281 | Miscanthus Phyllosphere | MKRDRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWK |
| Ga0182124_10074911 | 3300015282 | Miscanthus Phyllosphere | MSIQRRPPEASVRSGILSQDSNVKRGRERTKLTWVEAIKGNLKGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182124_10089491 | 3300015282 | Miscanthus Phyllosphere | CSGILSQDSNVKRGRGRPKLTWIEAIKGDLKGWNIPKDLALDRSAWKTTIHVSEP* |
| Ga0182124_10186621 | 3300015282 | Miscanthus Phyllosphere | APVRSGILSQDSNVKRGRGRPKLTWVEAIKGDLKEWNIPKDLALDRNAWKTAIHVPEP* |
| Ga0182124_10342871 | 3300015282 | Miscanthus Phyllosphere | TWVEAIKGDLKGWNISKDLALDRSAWKTAIHVPEP* |
| Ga0182124_10694131 | 3300015282 | Miscanthus Phyllosphere | WFGYVQRRPPEVPVRSGIISHDSNAKRDRGRPKLTWVEAIKEYLKEWNIPKDLVLDRSACKTVIHVPEP* |
| Ga0182156_10052802 | 3300015283 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSVWKTAIHVPKP* |
| Ga0182156_10148811 | 3300015283 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWLKAIKGDLKGRNIPKDLALDRSAWKTAIHVHEP* |
| Ga0182156_10698361 | 3300015283 | Miscanthus Phyllosphere | GRPKLTWVEAIKEELKGWNIPKDLALDRSAWKTAIHVAEP* |
| Ga0182156_10816711 | 3300015283 | Miscanthus Phyllosphere | QDSNMKRDRGRPKLTWVEAIKGDLKGWNIPEDLALDKSA* |
| Ga0182101_10514862 | 3300015284 | Switchgrass Phyllosphere | MQRRPPEAPMHSGIIRRNNDVKRGRGRPNLTWEEAVKRDLKDWNIMRELALDRAAWKAAIHVPEP* |
| Ga0182186_10032541 | 3300015285 | Miscanthus Phyllosphere | MKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182186_10047792 | 3300015285 | Miscanthus Phyllosphere | GRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182186_10123771 | 3300015285 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNISKDLALDRSAWKTAIHVPEP* |
| Ga0182186_10150211 | 3300015285 | Miscanthus Phyllosphere | VQRRPPKAPMRSGILSQDSNMKRGRGRPKLTWVQAIKGDLKGWNIPKDLALDRSTWKIASNIPGP* |
| Ga0182186_10182551 | 3300015285 | Miscanthus Phyllosphere | EAPVRSGILSQDSNVKRGRGRPKLTWVETIKGDLKGWNIPKDLALDRSAWKTAIHVHEP* |
| Ga0182186_10245081 | 3300015285 | Miscanthus Phyllosphere | RGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182186_10709292 | 3300015285 | Miscanthus Phyllosphere | MRPSEAPVCSGILSQDSNVKRDRGRPKLTWVEAIKGDLKGWNIPKDLALDMSACKTAIHVPEL* |
| Ga0182176_10181191 | 3300015286 | Miscanthus Phyllosphere | SGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182176_10451131 | 3300015286 | Miscanthus Phyllosphere | LSQDTNVKRGRGRPKLTWVETIKGDLKGWNMSKDLALDRSAWETAIHVPEP* |
| Ga0182176_10512911 | 3300015286 | Miscanthus Phyllosphere | SNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSA* |
| Ga0182176_10858881 | 3300015286 | Miscanthus Phyllosphere | KLTWVEAIKGVLKGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182171_10057061 | 3300015287 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNISKDLALDRSAWKTAIHVSEP* |
| Ga0182171_10269461 | 3300015287 | Miscanthus Phyllosphere | GRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVPEP* |
| Ga0182173_10043921 | 3300015288 | Miscanthus Phyllosphere | GRGRPKLTWVEAIKGDLKGWNIPKDLALGRSAWKTAIHVPEP* |
| Ga0182173_10080561 | 3300015288 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVHEP* |
| Ga0182173_10254141 | 3300015288 | Miscanthus Phyllosphere | PVRSGILIQDSNVKRGRGRPKLTWVEAIKEDLKGWNIPKDLALDTSAWKTAIHVPEL* |
| Ga0182173_10501391 | 3300015288 | Miscanthus Phyllosphere | ILSHDSNVKRSRVRPKFTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPDP* |
| Ga0182173_10596021 | 3300015288 | Miscanthus Phyllosphere | HVQRSPPEASVRSGILSQDSNVKRSRVRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHMPEP* |
| Ga0182173_10789781 | 3300015288 | Miscanthus Phyllosphere | MSNGRPPEAPVRSGILSQDSNVKRGKGRPKLTWVEAIKEDLKGWNIPKDLALDRSAWKTALHVPEP* |
| Ga0182138_10045302 | 3300015289 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRPKLTWVEAIKGDIKGWNIPKDLALDRSSWKIARHMPGP* |
| Ga0182138_10110382 | 3300015289 | Miscanthus Phyllosphere | MKRGTSRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182138_10246151 | 3300015289 | Miscanthus Phyllosphere | GILSQDSNVKGGRGRPKLTWVEAIKGDLKGWNIPKDLVLDRSAWKTAIHVPEP* |
| Ga0182138_10325071 | 3300015289 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVPEP* |
| Ga0182138_10615262 | 3300015289 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRLKLTWVEAIKGDLKGWNIPKDFALDRSAWKTAIHVPEL* |
| Ga0182125_10202801 | 3300015291 | Miscanthus Phyllosphere | VHSGILSQDSNVKRGRERPKLTWVEAIKGDLKGWNIPKDLALDRSSWKIAIHVPEP* |
| Ga0182125_10354241 | 3300015291 | Miscanthus Phyllosphere | GRPKLTWVEAIKGDLKGWNISKDLALDKSAWKTGIHVPEH* |
| Ga0182125_10500481 | 3300015291 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSVWKITIHVPKH* |
| Ga0182125_10670541 | 3300015291 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIH |
| Ga0182141_10014133 | 3300015292 | Miscanthus Phyllosphere | VPMHSGILSQGNNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSA* |
| Ga0182141_10218781 | 3300015292 | Miscanthus Phyllosphere | NVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAINVPEP* |
| Ga0182141_10258691 | 3300015292 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKELTLDRSAWKTSINVPEP* |
| Ga0182141_10376351 | 3300015292 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSTWKIAIHVPEP* |
| Ga0182141_10443772 | 3300015292 | Miscanthus Phyllosphere | LSQDSNMKRGRGRPKLTLVEAIKGDLTGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182103_10307951 | 3300015293 | Switchgrass Phyllosphere | LITVYSVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRSAWRLAI |
| Ga0182126_10102061 | 3300015294 | Miscanthus Phyllosphere | APVHSGILRQDSNVKRGRERLKLTWIEAIKEDLKGWNISKDLALDRSAWKTAIQVPEP* |
| Ga0182126_10123481 | 3300015294 | Miscanthus Phyllosphere | NVKRGRGRPKLTWVEAIKGDLKGWNIPKGLVLDRSAWKIAIHMPEP* |
| Ga0182126_10365351 | 3300015294 | Miscanthus Phyllosphere | PKLTWVEAIKGDLKGWNIPKDLALDTSAWKTAIHVPEP* |
| Ga0182126_10502441 | 3300015294 | Miscanthus Phyllosphere | NVKRGKGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAVHVPEP* |
| Ga0182175_10100751 | 3300015295 | Miscanthus Phyllosphere | RGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPKP* |
| Ga0182175_10176041 | 3300015295 | Miscanthus Phyllosphere | NVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHMPGP* |
| Ga0182175_10240491 | 3300015295 | Miscanthus Phyllosphere | LTWVEAIKGDLKGWNIPKDLALDRSVWKTAIHVLEP* |
| Ga0182175_10263981 | 3300015295 | Miscanthus Phyllosphere | DSNVKRGRERPKLTWVETIKGDLKGWNIPKDLALVRSAWKTAINVPEP* |
| Ga0182175_10660241 | 3300015295 | Miscanthus Phyllosphere | NMKRGRGRPKLTWVEAIKGDLKGWNIPKDLAIDRSAWKTAIHVPEP* |
| Ga0182157_10017704 | 3300015296 | Miscanthus Phyllosphere | SQDSNMKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSASKIAIHVPEP* |
| Ga0182157_10027261 | 3300015296 | Miscanthus Phyllosphere | NVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182157_10069823 | 3300015296 | Miscanthus Phyllosphere | NVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182157_10707891 | 3300015296 | Miscanthus Phyllosphere | LTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPKP* |
| Ga0182104_10086622 | 3300015297 | Switchgrass Phyllosphere | VQRRPPEAPVHSGIIRQNNEVKRGRGRPNLTWEEAVKRDLRDRNIMRELALDRASWKEAIHVPEP* |
| Ga0182106_10009581 | 3300015298 | Miscanthus Phyllosphere | VRSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVYEP* |
| Ga0182106_10091592 | 3300015298 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKEWNILKDLALDRSA* |
| Ga0182106_10200251 | 3300015298 | Miscanthus Phyllosphere | SGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182106_10982151 | 3300015298 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRPKLTWVEVIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182107_10018241 | 3300015299 | Miscanthus Phyllosphere | SNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182107_10111961 | 3300015299 | Miscanthus Phyllosphere | QDSNVKRGRGRPKLTWVEAIKGDLKGWNIPEDLALDRSVWKTAIHVPEP* |
| Ga0182107_10287451 | 3300015299 | Miscanthus Phyllosphere | PEAPVRSGILSQDSNVKRGRGRPKLTWVEAVKGDLKGWIIPKDLALDRSAWKTAIHVLDP |
| Ga0182107_10358141 | 3300015299 | Miscanthus Phyllosphere | VRSGILSQDSNVKRGRERPKLTWVETIKGDLKGWNMPKDLALDRSAWKIAIHVPEP* |
| Ga0182107_10383541 | 3300015299 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNTSKDLALDRSAWKIAIRVSES* |
| Ga0182107_10975151 | 3300015299 | Miscanthus Phyllosphere | DSNVKRDRARPKLTWIEAIKGDLKGWNIPKDLALDTSA* |
| Ga0182108_10045171 | 3300015300 | Miscanthus Phyllosphere | PVRSGILSQDSNVKRGRERPKLTWVEAIKGDLKGWNIRKDLALDRSAWKTAIHVPKP* |
| Ga0182108_10648131 | 3300015300 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVSEP* |
| Ga0182184_10457171 | 3300015301 | Switchgrass Phyllosphere | VQRRPPEAPVHSGIIRQNNEVKRGRGRPNLIWEEAVKRDLRDRDIMRELALDRAAWKEAIHVPEP* |
| Ga0182184_10536451 | 3300015301 | Switchgrass Phyllosphere | NVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP* |
| Ga0182143_10027141 | 3300015302 | Miscanthus Phyllosphere | QDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKAAIHVPEP* |
| Ga0182143_10209552 | 3300015302 | Miscanthus Phyllosphere | SNVKRGRERPKLTWVEAIKRDLKVWDILRDLCLNRSTWKAAIEVPEP* |
| Ga0182143_10465753 | 3300015302 | Miscanthus Phyllosphere | VRSGILSQDSNVKRGRGRPKLIWVEAIKGDLKGWNIPKDLALDRSAWK |
| Ga0182123_10066892 | 3300015303 | Miscanthus Phyllosphere | VRSGILSHDSNVKRGRGRPKLTWVKAIKGDLKGWNIPKDLALDRSAWKTAINVPEP* |
| Ga0182123_10272933 | 3300015303 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRPKLTWVETIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182123_10396701 | 3300015303 | Miscanthus Phyllosphere | PPEAPVRSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNTPKDLALDRSAWKIASHVPRP* |
| Ga0182123_10563531 | 3300015303 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVSEP* |
| Ga0182123_10961392 | 3300015303 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAGKTAIHVPEP* |
| Ga0182112_10337372 | 3300015304 | Miscanthus Phyllosphere | GILSQDSNVKKDRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVPEP* |
| Ga0182112_10473431 | 3300015304 | Miscanthus Phyllosphere | PKLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVPEP* |
| Ga0182112_10893371 | 3300015304 | Miscanthus Phyllosphere | QDSNVKRGGGRPKLTWVEAIKENLKGWNITKDLALDRSAWKTVIHVSEP* |
| Ga0182158_10050171 | 3300015305 | Miscanthus Phyllosphere | QDSNVKRGRGRPKLTWVEAIKGDLKGWNILKDLALDRSAWKIAIHVPEP* |
| Ga0182158_10127301 | 3300015305 | Miscanthus Phyllosphere | SQDSNVKRGRGRPKLTWVEAIKWDLKGWNIPKDLVLDRSAWKTAIHVPEP* |
| Ga0182158_10145891 | 3300015305 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSSWKAASNVPRP* |
| Ga0182158_10250182 | 3300015305 | Miscanthus Phyllosphere | PVRSGILSQDNNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVPEP* |
| Ga0182158_10402831 | 3300015305 | Miscanthus Phyllosphere | RGRPKLTWVHAIKEDLKGWNIPKNLALDRSAWKTAIHVSEP* |
| Ga0182158_10542902 | 3300015305 | Miscanthus Phyllosphere | QDSNVKRGRGRPKLIWVEAIKGDLKGWNIPKDLALDRSDWKTAIHVPES* |
| Ga0182158_10746951 | 3300015305 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182158_10815891 | 3300015305 | Miscanthus Phyllosphere | VKRGIVRPKLTWIEAIKGDFKGWNIRKDLALDRSAWKTAI |
| Ga0182180_10693421 | 3300015306 | Switchgrass Phyllosphere | DNVKRGRGRPKLTWDELVKRDLKDWNISKEIALDMSA* |
| Ga0182144_10289342 | 3300015307 | Miscanthus Phyllosphere | VRSEILTQDSNVKRGRERPKLTSVEAIKEDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182144_10868421 | 3300015307 | Miscanthus Phyllosphere | MRRGRGRPKLTWGEAIKRDLKAYDIFRDLCLNRSTWKAAIEVPEP* |
| Ga0182144_10917151 | 3300015307 | Miscanthus Phyllosphere | LVCSGILSQDSNIKRGGGRLKLTWVEAIKGDLKGWNIPKDLALDKSAWKTAIHVPKP* |
| Ga0182142_10104324 | 3300015308 | Miscanthus Phyllosphere | VPVCSGILSQDSNVKRGRGRPKLIWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPES* |
| Ga0182142_10258001 | 3300015308 | Miscanthus Phyllosphere | MRSGILGQDSNMKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSSWKIAIHVPGP* |
| Ga0182142_10794152 | 3300015308 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIVIHVPEP* |
| Ga0182098_10469922 | 3300015309 | Switchgrass Phyllosphere | NVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVSEP* |
| Ga0182162_10530292 | 3300015310 | Switchgrass Phyllosphere | GVLELVDNVKRGRGRPKLTWVESVKRDLKDWNISREIALDRSAWRLAINVPEL* |
| Ga0182182_10145121 | 3300015311 | Switchgrass Phyllosphere | VQRRPPEAPVHSGIIRQNNEVKRGRGRPNLTWEEAVKRDLRDRNIMRELALDRAAWKEAIHVPEP* |
| Ga0182182_10741372 | 3300015311 | Switchgrass Phyllosphere | NVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPDL* |
| Ga0182168_10638132 | 3300015312 | Switchgrass Phyllosphere | MHSGIIRRNNDVKRGRGRPNLTWEEAVKRDLKDWNIMRELALDRAAWKAAIHIPEP* |
| Ga0182168_11126471 | 3300015312 | Switchgrass Phyllosphere | KRGRGRPKLTWDESVKRDLKDWNISKEIVLDRSA* |
| Ga0182164_10901731 | 3300015313 | Switchgrass Phyllosphere | NVKRGRGRPKLTWDESVKRDLKDWNICKGIVLDRSA* |
| Ga0182140_10036611 | 3300015314 | Miscanthus Phyllosphere | NVKRGKGRPKLTWVEATKEDLKGWNITKDLALDRSSWKIAIHMPRP* |
| Ga0182140_10380031 | 3300015314 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWIEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182140_11165391 | 3300015314 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVHEP* |
| Ga0182130_10587751 | 3300015319 | Switchgrass Phyllosphere | KRGRGRPKLTWDESVKRDLKDWNISKEIALDRSA* |
| Ga0182165_10910061 | 3300015320 | Switchgrass Phyllosphere | LVDNVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWKLAINVPEP* |
| Ga0182127_10137103 | 3300015321 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSVWKTAIHVPEP* |
| Ga0182127_10234032 | 3300015321 | Miscanthus Phyllosphere | MLSQDSNVKRGRGRPKLIWVEAIKGDLKGWNIPKDLALDRSGWKTAIHVPEP* |
| Ga0182127_10597701 | 3300015321 | Miscanthus Phyllosphere | RGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVHEP* |
| Ga0182127_10769641 | 3300015321 | Miscanthus Phyllosphere | GRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVAEP* |
| Ga0182127_11174611 | 3300015321 | Miscanthus Phyllosphere | TWVEAIKGDLKGWNIPKDLALDRNAWKIAIHVPEP* |
| Ga0182127_11264032 | 3300015321 | Miscanthus Phyllosphere | RSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGLNILKDLALDRSAWKTAIHVPEP* |
| Ga0182110_10011641 | 3300015322 | Miscanthus Phyllosphere | ILSQDSNVKRGRGKPKLTWIEAIKEDLKGWNIHIDLALYRSAWKTAIHVQP* |
| Ga0182110_10159752 | 3300015322 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWVEAIKGDLKGRNISKDLALNRSAWKTAIHVHEP* |
| Ga0182110_10676371 | 3300015322 | Miscanthus Phyllosphere | PEAPVRSEILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVPEP |
| Ga0182110_11020081 | 3300015322 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182110_11071231 | 3300015322 | Miscanthus Phyllosphere | MKRDRGRPKLTWVEAIKEDLKGYNIPKDLALDKSAWKTAIHVPEPFASAGFQL* |
| Ga0182110_11109061 | 3300015322 | Miscanthus Phyllosphere | VRRRSPEAPVRSGILSQDSNVKRGRERPKLTWIEAIKGDLKGWNIPKDLALDRGAWKTAIHVLEP* |
| Ga0182129_10150211 | 3300015323 | Miscanthus Phyllosphere | VHSGILSQDSNMKRGRGRPKLTCVEAIKGDLKGWNIPKDLALDRSSWKIAIHMPRP* |
| Ga0182129_10641771 | 3300015323 | Miscanthus Phyllosphere | QDSNVKRDRGRPKLTWVEAIKEDLKGWNIPKDLALDKSAWRTAIHVTES* |
| Ga0182129_10893751 | 3300015323 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHMPEP* |
| Ga0182129_11117681 | 3300015323 | Miscanthus Phyllosphere | PKLTWVEAIKRDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182166_10151401 | 3300015326 | Switchgrass Phyllosphere | DNVKRGRCRPKLTWDESVKRDLKNWNISKEIALDRST* |
| Ga0182166_10792881 | 3300015326 | Switchgrass Phyllosphere | KRGRGRPKLTWDELVKRDLKDWNISKEVALDRSA* |
| Ga0182166_10935631 | 3300015326 | Switchgrass Phyllosphere | ERVDNVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRSA* |
| Ga0182114_10051991 | 3300015327 | Switchgrass Phyllosphere | KRGRGRPKLMWDESVKRDLKDWNISKEIVLDRSA* |
| Ga0182114_10331753 | 3300015327 | Switchgrass Phyllosphere | VHSGIISRNNDVKRGRGRPKLTWEETVKRDIKDWNIMRELALDRAAWKAAIHVPEP* |
| Ga0182114_11619031 | 3300015327 | Switchgrass Phyllosphere | RGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP* |
| Ga0182153_11133871 | 3300015328 | Switchgrass Phyllosphere | RGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAIDVPEP* |
| Ga0182152_10806021 | 3300015330 | Switchgrass Phyllosphere | DNVKRGRGRPKLTWDESVKRDLKDWNISKEIVLDRSA* |
| Ga0182152_11233002 | 3300015330 | Switchgrass Phyllosphere | VHSSIISRNNDVKRGRGRPKLTWEETVKRDLKDWNIMRELALDRAAWKAAIHVPEP* |
| Ga0182131_10195221 | 3300015331 | Switchgrass Phyllosphere | VHSGVLKHDGNLKRGRGRPKLTWEETVRKNLKEWNIFGDLALNRSAWKAAIHVPEP* |
| Ga0182131_11138831 | 3300015331 | Switchgrass Phyllosphere | MRVDNVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRSAW |
| Ga0182117_10015241 | 3300015332 | Switchgrass Phyllosphere | PVHSGIISRNNDVKRGRGRPKLTWEETVKRDLKDWNIMRELALDRAAWKAAIHVPEP* |
| Ga0182117_10284371 | 3300015332 | Switchgrass Phyllosphere | VLELVDNVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP* |
| Ga0182147_10059891 | 3300015333 | Switchgrass Phyllosphere | VHSGIISRNNDVKRGRGRPKLTWEETVKRDLKDWNIMRELALDRAAWKAAIHVPEP* |
| Ga0182132_10939031 | 3300015334 | Switchgrass Phyllosphere | NNEVKRGRGQPSLTWEEVVKRDLRDWNIMRELALDRAAWKAAIHVPEP* |
| Ga0182150_10159752 | 3300015336 | Switchgrass Phyllosphere | VHSGIISRNNDVKRGRGRPKLTWEETVKRDLKDWNIMRELALDKAAWKAAIHVPEP* |
| Ga0182150_10939131 | 3300015336 | Switchgrass Phyllosphere | GRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAFNVPEP* |
| Ga0182150_11242651 | 3300015336 | Switchgrass Phyllosphere | GVLELVDNVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP* |
| Ga0182137_10303681 | 3300015338 | Switchgrass Phyllosphere | HSGIIRRNNEVKRGRGRPNLTWEEAVKRDLRDRNIMRELALDRAAWKEAIHVPEP* |
| Ga0182137_11165631 | 3300015338 | Switchgrass Phyllosphere | NVKRGRGRSKLTWDESVKRDLKDWNIPKKWLWLGALGD* |
| Ga0182149_10811281 | 3300015339 | Switchgrass Phyllosphere | MFNVKRGRGRPKLTWDESVKRDLKDWNISKEIALD |
| Ga0182149_10970551 | 3300015339 | Switchgrass Phyllosphere | VQQRPPEAPVHSGIIRRNNEVKRGRGRPNLTWEEAVKRDLRDRNIMRELALDRAAWKEAIHMPEP* |
| Ga0182187_10033271 | 3300015341 | Miscanthus Phyllosphere | DSNVKRDRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHMPEP* |
| Ga0182187_10199481 | 3300015341 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKELALDRSVWKTTIHVPEP* |
| Ga0182187_10253461 | 3300015341 | Miscanthus Phyllosphere | RILSQDSNVKRGRGRPKLTWVEAIKGDLGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182187_10297462 | 3300015341 | Miscanthus Phyllosphere | RGTGIPKFTWIEAIKGDLKGWNISKDLALDRSAGKTAIHVPEP* |
| Ga0182187_10314851 | 3300015341 | Miscanthus Phyllosphere | RPKLTWVEAIKGDLKGWNISKDLALDRSAWKTAIHVPEP* |
| Ga0182187_10449671 | 3300015341 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIQVPEP* |
| Ga0182187_10528451 | 3300015341 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSARKTAIHVSEP* |
| Ga0182187_10772632 | 3300015341 | Miscanthus Phyllosphere | DSNVKRGRERPKLTWVEAIKGDLKGWNIPKDLTLDRSAWKTAIHVPEP* |
| Ga0182187_11189111 | 3300015341 | Miscanthus Phyllosphere | DSNVKRGKGRPKLTWVEAIKGDLKGWNIPKDLVLDRSAWKTAIHVPEP* |
| Ga0182187_11324911 | 3300015341 | Miscanthus Phyllosphere | RGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSVWKIAIHMPKP* |
| Ga0182187_11463491 | 3300015341 | Miscanthus Phyllosphere | VRIGILSQDSNVKRGRGKPKLTWVEVIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182187_11540011 | 3300015341 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAW |
| Ga0182109_10009681 | 3300015342 | Miscanthus Phyllosphere | VRSEILSQDSNVKRGRGRPKLTWVESIKGDLKGWNIAKDLALDRSAWKTAIHVPKP* |
| Ga0182109_10040202 | 3300015342 | Miscanthus Phyllosphere | RRPPEAPVCSGILSQDSNVKRGRGRPKLTLVETIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182109_10070071 | 3300015342 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNIPKDLALDRSAWKIASHVPGP* |
| Ga0182109_10141441 | 3300015342 | Miscanthus Phyllosphere | DSNVKRGKGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVPEP* |
| Ga0182109_10374012 | 3300015342 | Miscanthus Phyllosphere | FPFYLCYSTLSQDSNVKRGRGRPKLTWVEAIKGDLKGCNIPKDLALDRSAWKTAIHVSEP |
| Ga0182109_10476401 | 3300015342 | Miscanthus Phyllosphere | KLTWVDAIKGDLKGWNIPKDLALDRSAWKTAIHVLEP* |
| Ga0182109_10523202 | 3300015342 | Miscanthus Phyllosphere | RSGILSQDSNVKRGRGRPKLTWVEAIKGDLKRWNIPKDLALDRSAWQTAIHVPEP* |
| Ga0182109_10729781 | 3300015342 | Miscanthus Phyllosphere | RGRGRPKLTWVEAIKEDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182109_10760981 | 3300015342 | Miscanthus Phyllosphere | APVRSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNISKDLALDRSAWKTAINVPEP* |
| Ga0182109_10867471 | 3300015342 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVCEP* |
| Ga0182109_11007841 | 3300015342 | Miscanthus Phyllosphere | PPEAPVCSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNMPKDLALDRSAWKIAIHVPGP* |
| Ga0182109_11099521 | 3300015342 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182109_11217432 | 3300015342 | Miscanthus Phyllosphere | SQDSNVKRGRGRPKLTWVEAIKGDLKEWNIPKDLALDRSAWKTAIHVPEH* |
| Ga0182109_11268551 | 3300015342 | Miscanthus Phyllosphere | TWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVPEP* |
| Ga0182109_11392082 | 3300015342 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHMPEL* |
| Ga0182109_11658352 | 3300015342 | Miscanthus Phyllosphere | VKRGRERPKLTWVEAIEGDLKGWNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182109_11893651 | 3300015342 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRNDWKTAIHVPEP* |
| Ga0182155_10029113 | 3300015343 | Miscanthus Phyllosphere | SQDNNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSA* |
| Ga0182155_10057851 | 3300015343 | Miscanthus Phyllosphere | VKRGRGRPKLTWVETIKGDLKGWNIPKDLALDRSAWKTAIHMPEP |
| Ga0182155_10259051 | 3300015343 | Miscanthus Phyllosphere | NVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHMSKP* |
| Ga0182155_10363831 | 3300015343 | Miscanthus Phyllosphere | NVKRGRGRPKLTWVQAIKGDLKGWNIPKDLALDRSA* |
| Ga0182155_10388054 | 3300015343 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRPKLTWVETIKGDLKGWNISKDLALDRSAWKTAIHVPEP* |
| Ga0182155_10613941 | 3300015343 | Miscanthus Phyllosphere | RGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVSEP* |
| Ga0182155_10704132 | 3300015343 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVPEP* |
| Ga0182155_10767443 | 3300015343 | Miscanthus Phyllosphere | QDSNVKRGRGRPKFTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHAPEP* |
| Ga0182155_11106181 | 3300015343 | Miscanthus Phyllosphere | MDYQQYSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIH |
| Ga0182155_11284192 | 3300015343 | Miscanthus Phyllosphere | RGRGRPKLTWIDAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182155_11349953 | 3300015343 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWIEAIKGDLKGWNISKDLALDRSAWKTAIHLPEP* |
| Ga0182155_11804181 | 3300015343 | Miscanthus Phyllosphere | VGTFAKVKKLVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSVWKIAIHMPKP* |
| Ga0182155_11906441 | 3300015343 | Miscanthus Phyllosphere | VRSGILSHDSNMKRGRGRSKLTWVEALKGDLKGWNISKDLALDRSAWKTAIHVPEP* |
| Ga0182189_10228162 | 3300015344 | Miscanthus Phyllosphere | GRPMLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182189_10580811 | 3300015344 | Miscanthus Phyllosphere | SQDGNVKRGRGRPKLTWVETIKGDLKGWNIPKDLTLDRSAWKTAIHVPEP* |
| Ga0182189_10974641 | 3300015344 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVSES* |
| Ga0182189_11084641 | 3300015344 | Miscanthus Phyllosphere | QVRSEILSQDSNVKRGRGRPKLTWVESIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182189_12029401 | 3300015344 | Miscanthus Phyllosphere | RSGILSQDNNVKRGRGRPKLIWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182189_12081972 | 3300015344 | Miscanthus Phyllosphere | PKLTWVEAIKGDLKGWNIPKDLALDRSARKTAIHVSEP* |
| Ga0182189_12152071 | 3300015344 | Miscanthus Phyllosphere | RPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPKP* |
| Ga0182189_12198962 | 3300015344 | Miscanthus Phyllosphere | RGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTSIHVSEP* |
| Ga0182111_10169921 | 3300015345 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSGWKTTIHVPEP* |
| Ga0182111_10213591 | 3300015345 | Miscanthus Phyllosphere | VRSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRNDWKTAIHVPEP* |
| Ga0182111_10299081 | 3300015345 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNISKDLALDRSAWKTAIHVPEP* |
| Ga0182111_10403761 | 3300015345 | Miscanthus Phyllosphere | DSNVKRGRGRLKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182111_10735771 | 3300015345 | Miscanthus Phyllosphere | EILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKELALDRSVWKTTIHVPEP* |
| Ga0182111_10829301 | 3300015345 | Miscanthus Phyllosphere | PKLTWIEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182111_10852471 | 3300015345 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVPKP* |
| Ga0182111_11137121 | 3300015345 | Miscanthus Phyllosphere | RGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPKP* |
| Ga0182111_11327021 | 3300015345 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKEWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182111_11396401 | 3300015345 | Miscanthus Phyllosphere | VKRGKGRPKLTWVEAIKGYLKGWNIPKDLALDRSAWKTAIH |
| Ga0182111_11488181 | 3300015345 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWIEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182111_12058791 | 3300015345 | Miscanthus Phyllosphere | VRSGILSQDSNVKRGRGRPELTWIEAIKGDLKGWNISKELALHRSACKTVIHVPEP* |
| Ga0182111_12251401 | 3300015345 | Miscanthus Phyllosphere | DSNVKRDRGRPKLTWVEAIKGDLKGWNISKDLALDRSAWKTAIHVREP* |
| Ga0182111_12367171 | 3300015345 | Miscanthus Phyllosphere | QDSNVKRGRGRPKLTWVEAIKGDLKGWNISKDLALDRSAWKTAIHVPEP* |
| Ga0182139_10020713 | 3300015346 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKEDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182139_10382831 | 3300015346 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWIDAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182139_10512372 | 3300015346 | Miscanthus Phyllosphere | VFPFYLCYSTLSQDSNVKRGRGRPKLTWVEAIKGDLKGCNIPKDLALDRSAWKTAIHVSEP* |
| Ga0182139_11381051 | 3300015346 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182139_11466911 | 3300015346 | Miscanthus Phyllosphere | APVRSGILSQDSNVKRGRGRPKLTWVEAIEGDLKGWNILKDLALDRSAWKTAIHVPEP* |
| Ga0182139_11526881 | 3300015346 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKEDLKGWNIPKDLALDRSAWKTAIHMPEP* |
| Ga0182139_11661412 | 3300015346 | Miscanthus Phyllosphere | LSQDSNMKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182139_11860251 | 3300015346 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKGLVLDRSAWKTAIHVPDP* |
| Ga0182139_11866021 | 3300015346 | Miscanthus Phyllosphere | MRSGILSQDSNVKRDIRRPKLTWIEAIKGDLKGWNISKDLALDRSA* |
| Ga0182139_12411871 | 3300015346 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWVEAIKEDLKEWNIPKDLALDRNAWKIAIHVPEP* |
| Ga0182177_10175742 | 3300015347 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWVEVIKRDLKGWNISKDLALYRSAWKTAIHVPEP* |
| Ga0182177_10298041 | 3300015347 | Miscanthus Phyllosphere | VRSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLVLDRSAWKTAIHVPEPLLLLGFNSSLS* |
| Ga0182177_10320531 | 3300015347 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPQP* |
| Ga0182177_10425401 | 3300015347 | Miscanthus Phyllosphere | SNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVSEL* |
| Ga0182177_10757652 | 3300015347 | Miscanthus Phyllosphere | ETPVRSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKNLALDRSAWKTAIHVLEP* |
| Ga0182177_10792542 | 3300015347 | Miscanthus Phyllosphere | VQRRPPEAPVRSGILSQDSNMKRGKGRLKLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVPEP* |
| Ga0182177_11318911 | 3300015347 | Miscanthus Phyllosphere | RGRPKLTWVLAIKGDLRGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182177_11619932 | 3300015347 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPGP* |
| Ga0182177_11640011 | 3300015347 | Miscanthus Phyllosphere | DSNVKRGRGRPQLTWVEAIKGDLKGWNIPKDLALDRSA* |
| Ga0182177_11760231 | 3300015347 | Miscanthus Phyllosphere | RDRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVPEP* |
| Ga0182177_12102601 | 3300015347 | Miscanthus Phyllosphere | ILSQDSNVQRGRGRPKLTWVETIKGDLKGWNIPKDLALDRSVWKTTIHVPEP* |
| Ga0182115_10001877 | 3300015348 | Switchgrass Phyllosphere | VHSSIISRNNDVKRGRGRPKLTWEETVKRDLKDWNIMRELALDKAAWKAAIHVPEP* |
| Ga0182115_10264913 | 3300015348 | Switchgrass Phyllosphere | MFNVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRSAWRLAI |
| Ga0182115_10397431 | 3300015348 | Switchgrass Phyllosphere | VDNVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRSA* |
| Ga0182115_10801551 | 3300015348 | Switchgrass Phyllosphere | VLKHVDKVKRGRCRPKLTWDESVKRDLKDWDISEELA |
| Ga0182115_11105881 | 3300015348 | Switchgrass Phyllosphere | RPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPES* |
| Ga0182115_11669361 | 3300015348 | Switchgrass Phyllosphere | DNVKRGRGRPKLTWDDSVKRDLEDWNISKEIALDRSA* |
| Ga0182115_11936702 | 3300015348 | Switchgrass Phyllosphere | LITVYSVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRSAW |
| Ga0182185_11440332 | 3300015349 | Switchgrass Phyllosphere | MHSGIIRWNNEVKRGRGRPHLTWEEAVKRDLRDRNIMRELALDRAAWTEAIHVPEP* |
| Ga0182185_12305662 | 3300015349 | Switchgrass Phyllosphere | ERVDNVKRGRGRPKLTWDESVKRDLKDWNISKEIVLDRSA* |
| Ga0182163_10259971 | 3300015350 | Switchgrass Phyllosphere | MFNVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRSAWRLA |
| Ga0182163_10316042 | 3300015350 | Switchgrass Phyllosphere | MKRGRGRLKLTWEEAIKEDLKGWNIAKDLVLNRGASKTAINVPER* |
| Ga0182161_10034052 | 3300015351 | Miscanthus Phyllosphere | RPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182161_10069722 | 3300015351 | Miscanthus Phyllosphere | MKRGRERPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEY* |
| Ga0182161_10086701 | 3300015351 | Miscanthus Phyllosphere | NIKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVSEP* |
| Ga0182161_10124423 | 3300015351 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNISKDLALDRSTWKTTIHVSEH* |
| Ga0182161_10142473 | 3300015351 | Miscanthus Phyllosphere | VRSGILSQDNNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWK |
| Ga0182161_10205571 | 3300015351 | Miscanthus Phyllosphere | RPPEAPVRSGILSQDSNVKRGRGRPKLTWAEVIKGDLKGWNIPKDLALDRSA* |
| Ga0182161_10390292 | 3300015351 | Miscanthus Phyllosphere | VRSVILSQDSNVKRGRGRPKLTWVEVIKGDLKGWNIPKDLALDKSAWKTAIHVPEP* |
| Ga0182161_10480601 | 3300015351 | Miscanthus Phyllosphere | VRSGILSQDSNMKRGRGRPKLTWVEAIKGDLKGCNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182161_10536193 | 3300015351 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGLNIPKDLALDRSAWKTAIHMPEP* |
| Ga0182161_10545741 | 3300015351 | Miscanthus Phyllosphere | RSGILSQDSNVKRGRGRPKLTWVETIKGDLKGWNIHKDLALDRSAWKTAIHVPEP* |
| Ga0182161_11257592 | 3300015351 | Miscanthus Phyllosphere | KRDRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP* |
| Ga0182161_11600601 | 3300015351 | Miscanthus Phyllosphere | RPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAVHVLEP* |
| Ga0182161_11715402 | 3300015351 | Miscanthus Phyllosphere | NVKRGRGRPKLTWVEAIKGDLKGWNILKDLALDRSAWKTAIHVPEP* |
| Ga0182161_11936621 | 3300015351 | Miscanthus Phyllosphere | GILSQDSNMKRDRGRPNMTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVSEP* |
| Ga0182161_12384331 | 3300015351 | Miscanthus Phyllosphere | QDSNVKRGRGRPKLTWVEAIKEDLKGWNIPKDLALDRSAWKTALHVPEP* |
| Ga0182169_10564171 | 3300015352 | Switchgrass Phyllosphere | HSGIIRRNNDVKRGRGRPNLTWEEAVKRDLKDWNIMRELALDRAAWKAAIHVPEP* |
| Ga0182169_10771181 | 3300015352 | Switchgrass Phyllosphere | KRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVSEP* |
| Ga0182167_10194851 | 3300015354 | Switchgrass Phyllosphere | KRGRGRPKLTWDESVKRDLMVWNISKEIALNRSAGN* |
| Ga0182167_10845211 | 3300015354 | Switchgrass Phyllosphere | ERVDNVKRGRGRPKLTWDESVKRDLKDWNISKEKALDRSA* |
| Ga0182167_13127132 | 3300015354 | Switchgrass Phyllosphere | VHSGIIRRNNEVKRGRGRPNLTWEEAVKRDLRDRNIMRELALDRAAWKEAIHVPEP* |
| Ga0182159_10103051 | 3300015355 | Miscanthus Phyllosphere | RGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPKP* |
| Ga0182159_10119731 | 3300015355 | Miscanthus Phyllosphere | QDSNVKRGGGRPKLTWVEAIKGDLKGWNMPKDLALDRSAWKTAIHVPEP* |
| Ga0182159_10229721 | 3300015355 | Miscanthus Phyllosphere | APVRSGILSLDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKPAIHVPEP* |
| Ga0182159_10322922 | 3300015355 | Miscanthus Phyllosphere | SQDSNVKRSRGRPKLTWVEAIKEDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182159_10381411 | 3300015355 | Miscanthus Phyllosphere | RPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTSIHVPEP* |
| Ga0182159_10546651 | 3300015355 | Miscanthus Phyllosphere | GRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP* |
| Ga0182159_10552941 | 3300015355 | Miscanthus Phyllosphere | QDSNVKRGRGRPKLTWVEAIKEDLKGWNIPKDLALDRSARKTAIHVPEP* |
| Ga0182159_10653671 | 3300015355 | Miscanthus Phyllosphere | PPEAPVRSGILSQDSNVKRGRGRPKLTWVQAIKGDLKGWNIPKDLALDRNAWKTAIHVPEP* |
| Ga0182159_10788471 | 3300015355 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP* |
| Ga0182159_11106801 | 3300015355 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNISKELALDRSAWKTTIHVPEP* |
| Ga0182159_11569751 | 3300015355 | Miscanthus Phyllosphere | LTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVPEP* |
| Ga0182159_11761162 | 3300015355 | Miscanthus Phyllosphere | MRRGRGRPKLTWGEAIKKDLKGWDIPRDLCLDRSA* |
| Ga0182159_12666741 | 3300015355 | Miscanthus Phyllosphere | MKRGRGRPNLTWVEAIKGYLKEWNIPKDLALGRSAWKIAIHMLES* |
| Ga0182159_13021721 | 3300015355 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSTWKTVIHVPEP* |
| Ga0182159_13218321 | 3300015355 | Miscanthus Phyllosphere | VRSGILSQDNYVKRGRGIPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVLEP* |
| Ga0182145_10346271 | 3300015361 | Miscanthus Phyllosphere | SQDSNVKRGRGRPKLTWVEAIKGDLKGWNISKVLALDRSAWKIAIHVPEP* |
| Ga0182145_10508022 | 3300015361 | Miscanthus Phyllosphere | RSEILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALEISAWKTAIHVPES* |
| Ga0182145_10897241 | 3300015361 | Miscanthus Phyllosphere | VRSGILSQDNNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTA |
| Ga0182145_11348581 | 3300015361 | Miscanthus Phyllosphere | SQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLSLDRSAWKTAIHVPEP* |
| Ga0182203_10006874 | 3300017404 | Miscanthus Phyllosphere | RPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182203_10105001 | 3300017404 | Miscanthus Phyllosphere | GRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP |
| Ga0182203_10136291 | 3300017404 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182203_10179481 | 3300017404 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNISKDLALDRSAWKTAIHVPEP |
| Ga0182203_10199001 | 3300017404 | Miscanthus Phyllosphere | RGRGRPKLTWVEAIKGDLKGWNIPKNLALDRSAWKTAIHVPEP |
| Ga0182203_10250061 | 3300017404 | Miscanthus Phyllosphere | HVQRRPPEAPVHSGILSQNSNVKRDRGRPKLTWVEAIKGDLKGWNILKGLALDRSARKTAIHVPEP |
| Ga0182203_10445091 | 3300017404 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKNLALDKSAWKTAIHVPEP |
| Ga0182203_10520371 | 3300017404 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRIVWKTAIHVPEP |
| Ga0182203_10705692 | 3300017404 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182203_10777241 | 3300017404 | Miscanthus Phyllosphere | RRRPKLTWVEAIKGDLKDKNIPKNLALDRSAWKTVIYMPEP |
| Ga0182203_10930292 | 3300017404 | Miscanthus Phyllosphere | VKRGRRRLKLTWVEVIKGDLKVWNIPKDLALDRSAWKTAIHVPKPFASAGFQR |
| Ga0182203_11129622 | 3300017404 | Miscanthus Phyllosphere | GRPKLTWIEAIKGDLKGWNIPKDLALDRSAWKTVNHVPEP |
| Ga0182220_10453272 | 3300017407 | Miscanthus Phyllosphere | NMKRGRGRPKLTWVEAIKGDLKGWNIPKDLDLDKSAWKTAIHVLEP |
| Ga0182204_11093441 | 3300017409 | Miscanthus Phyllosphere | SNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSVWKTAIHVPEP |
| Ga0182207_10086171 | 3300017410 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP |
| Ga0182207_10186941 | 3300017410 | Miscanthus Phyllosphere | SGILSQDSNGKRGRGRPKLTWIETIKGDLKGWNIPKDLALDRSAWKTAIHMPES |
| Ga0182207_10477931 | 3300017410 | Miscanthus Phyllosphere | VRSGILSQDSNMKRGRGRPKLTWVEAIKEDMKGLNIPKDLALDRSAWKTVIHVPEP |
| Ga0182207_10490072 | 3300017410 | Miscanthus Phyllosphere | RGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182207_10630042 | 3300017410 | Miscanthus Phyllosphere | NVKRGRGRPKLTWVETIKGDLKGWNIPKDLALDRSAWKTAIHMPEP |
| Ga0182207_10653271 | 3300017410 | Miscanthus Phyllosphere | GILSQDSNVKRGRERPKLTWIEAIKGDLKGWNIPKDLALDSSASKKTIHVLEP |
| Ga0182207_11017371 | 3300017410 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVPEP |
| Ga0182207_11480191 | 3300017410 | Miscanthus Phyllosphere | RGRPKLTWVEAIKGDLKGWNIPKDLALGRSAWKTAIHVPEP |
| Ga0182207_11498392 | 3300017410 | Miscanthus Phyllosphere | GRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP |
| Ga0182207_11504872 | 3300017410 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKGLALDRSAWKTVIHVPEP |
| Ga0182208_10029101 | 3300017411 | Miscanthus Phyllosphere | PKLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVPEP |
| Ga0182208_10831401 | 3300017411 | Miscanthus Phyllosphere | VRSGILSQDSNVKRGRERPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHV |
| Ga0182208_11281991 | 3300017411 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSVWKTTIHVPEP |
| Ga0182222_10782452 | 3300017413 | Miscanthus Phyllosphere | VRSEILSQDSNVKRGRERPKLTWVEAIKGDLKGWNIPKDLALDRSSWKIAIHVPGP |
| Ga0182222_10808171 | 3300017413 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP |
| Ga0182202_10040973 | 3300017415 | Miscanthus Phyllosphere | RSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKNLAFDRSAWKTAIHVPEP |
| Ga0182202_10050561 | 3300017415 | Miscanthus Phyllosphere | LTWVEAIKGDLKGWNISKDLALDRSAWKTAIHVPEP |
| Ga0182202_10058862 | 3300017415 | Miscanthus Phyllosphere | RGRGRPKLTWVEAIKGDLKGWNILKDLVLDRSAWKTAIHVSEP |
| Ga0182202_10214941 | 3300017415 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNILKDLALDRSVWKTAIHVPEP |
| Ga0182202_10215241 | 3300017415 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRNAWKIAIHVPEP |
| Ga0182202_10551941 | 3300017415 | Miscanthus Phyllosphere | VRSGILSQDSNLKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP |
| Ga0182202_11153101 | 3300017415 | Miscanthus Phyllosphere | RGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP |
| Ga0182228_10106631 | 3300017420 | Miscanthus Phyllosphere | QDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSVWKTSIHVPEP |
| Ga0182228_10441932 | 3300017420 | Miscanthus Phyllosphere | ILSQDSNVKRDRGRSKLIWVETIKGDLKGWNIPKDLALDRSVWKIAIHVSES |
| Ga0182228_10937141 | 3300017420 | Miscanthus Phyllosphere | GILSQDSNVKRDRGRPKLTWVDVIKEHLKGWNIPKDLAFDRSAWKIAIHVPEP |
| Ga0182213_11651262 | 3300017421 | Switchgrass Phyllosphere | FDNVKRGRGRPKLTWDESVKRSFKDWNISKEIVLDSSA |
| Ga0182219_10351801 | 3300017424 | Miscanthus Phyllosphere | VQRRPPKAPVRSEILSQDSNVKRGRGRPKLTWIEAIKGDLKEWNIPKDFALDRNAWKKVIYEPGP |
| Ga0182219_10661341 | 3300017424 | Miscanthus Phyllosphere | RPKLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVPEP |
| Ga0182219_11316381 | 3300017424 | Miscanthus Phyllosphere | RPPEASVRSGILSQDSNVKRGRGRPKLTWVEAIKEDFKVWNIPKDLGLDRSAWKIVIHVPEP |
| Ga0182224_10180831 | 3300017425 | Miscanthus Phyllosphere | VRSGILSQDSNVTRDRGRPKLNWVEAIKGDLKGWNIPKDLALDRSARKTAIHVPEP |
| Ga0182224_10342381 | 3300017425 | Miscanthus Phyllosphere | VKRGKGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182224_10357913 | 3300017425 | Miscanthus Phyllosphere | LIWVEAIKGDLKGWNIPKDLALDRSVWKTAIHVPEP |
| Ga0182224_10415251 | 3300017425 | Miscanthus Phyllosphere | SQDSNVKRDRGRLKLTWVEAIKGDLKGWNVSKDLALDRSAWKTAIHVLEP |
| Ga0182224_10426182 | 3300017425 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182224_10753951 | 3300017425 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVAEP |
| Ga0182224_10757831 | 3300017425 | Miscanthus Phyllosphere | GRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPKP |
| Ga0182224_11202251 | 3300017425 | Miscanthus Phyllosphere | RGRPKLTWIETIKGDLKGWNISKDLALDRSTWKTTIHVSEH |
| Ga0182224_11524311 | 3300017425 | Miscanthus Phyllosphere | SNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTVIHVLEP |
| Ga0182190_10245262 | 3300017427 | Miscanthus Phyllosphere | PEAPVRSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNILKDLALDRSAWKTAIHVLEP |
| Ga0182190_10335791 | 3300017427 | Miscanthus Phyllosphere | VKRGRGRPKLTRVEAIKGDLKGWNIPKDLAFDRNAWKTAIHVPEP |
| Ga0182190_10359451 | 3300017427 | Miscanthus Phyllosphere | RPKLTWVEAIKGDLKGWNISKDLALDRSAWKTAIHVPKP |
| Ga0182190_10478691 | 3300017427 | Miscanthus Phyllosphere | SNVKRGRGRPKLTWVEAIKGDLKGWNISKDLALDRSAWKPEP |
| Ga0182190_10654591 | 3300017427 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVSEP |
| Ga0182190_10794641 | 3300017427 | Miscanthus Phyllosphere | VCEVDSNVKRGKGRPKLTWVEAIKGDLKGSNIPKDLALDRSAWKTAIHVPEP |
| Ga0182190_10990072 | 3300017427 | Miscanthus Phyllosphere | GRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182192_10040602 | 3300017430 | Miscanthus Phyllosphere | VRSGILSQDSNVKRERERPKLTWVEAIKEDLKGWNIPKDFALDRSDWKTAIHVPKP |
| Ga0182192_10268402 | 3300017430 | Miscanthus Phyllosphere | GKPKLTWVEAIKGDLKGWNIPKNIALDRSARKIAIHVPEP |
| Ga0182192_11163851 | 3300017430 | Miscanthus Phyllosphere | MRSGILGQDSNMKRGRGRPKLTWVEAIKGDLKGCNIPKDLALDRSASKTAIHVPEP |
| Ga0182192_11383662 | 3300017430 | Miscanthus Phyllosphere | MRSGILSHDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHV |
| Ga0182192_11422252 | 3300017430 | Miscanthus Phyllosphere | VHSGILSQDSNLKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIH |
| Ga0182192_11442681 | 3300017430 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTSIHVPEP |
| Ga0182196_11007091 | 3300017432 | Switchgrass Phyllosphere | VHSGIISRNNDVKRGRGRPKLTWEETVKRDIKDWNIMRELALDRAAWKAAIHVPEP |
| Ga0182206_10297031 | 3300017433 | Miscanthus Phyllosphere | EILSQDSNVKRGRGRPKLTWAAAIKGDLKRWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182206_11563471 | 3300017433 | Miscanthus Phyllosphere | PKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182209_10114041 | 3300017436 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWIEAIKRDLKGCNILKDLALDRSAWKTAIHVPEP |
| Ga0182209_10500781 | 3300017436 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSARKTAIHVPEP |
| Ga0182209_10713092 | 3300017436 | Miscanthus Phyllosphere | GRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVSGP |
| Ga0182209_11040591 | 3300017436 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDVALDRSAWKTAIHVLEP |
| Ga0182209_11248941 | 3300017436 | Miscanthus Phyllosphere | GRGRPKLTWVEAIKGDLKGWNIPKDLALDRSVWKTAIHVPEP |
| Ga0182191_10065604 | 3300017438 | Miscanthus Phyllosphere | SGILSHDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLVLDRSAWKTAIHVPEP |
| Ga0182191_10639382 | 3300017438 | Miscanthus Phyllosphere | APVRSGILSQDSNVKRGRGRPKLTWIEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP |
| Ga0182191_11446821 | 3300017438 | Miscanthus Phyllosphere | RGRPKLTWVEAIKGDLKGWNIPKDLVLDRSAWKTVIHVPEP |
| Ga0182191_11592851 | 3300017438 | Miscanthus Phyllosphere | VKRGRGRPTWVEAIKGDLKEWNIPKDLALDRSAWKTAIHVPEPWIASAGFQL |
| Ga0182191_11743281 | 3300017438 | Miscanthus Phyllosphere | QDSNVKRGRGRPKFTWVEAIKGNLKGWNIPKDLALDMSVWKIANHVPEP |
| Ga0182200_10509091 | 3300017439 | Switchgrass Phyllosphere | RPPEAPVHSGIISRNNDVKRGRGRPKLTWEETVKRDLKDWNIMRELALDRAAWKAAIHVPEP |
| Ga0182221_10028991 | 3300017442 | Miscanthus Phyllosphere | SNVKRGRGRPKLTWVEAIKGDLKGWNITKDFALDRSAWKTAIHVPEP |
| Ga0182221_10047541 | 3300017442 | Miscanthus Phyllosphere | KLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVSEP |
| Ga0182221_10362671 | 3300017442 | Miscanthus Phyllosphere | QDSNVKRDRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIEVPEP |
| Ga0182221_10371932 | 3300017442 | Miscanthus Phyllosphere | LSLDSNVKRGRGRPKLTWVEAIKGDLKGWNMPKDLVLDRSAWKTAIHVPEP |
| Ga0182221_10442892 | 3300017442 | Miscanthus Phyllosphere | EAPVHSGILSQDSNVKRDRGRPKLTWVETIKGDLKGIPKDLDLDRSAWKTAIHVPEP |
| Ga0182221_10625541 | 3300017442 | Miscanthus Phyllosphere | EVLSRDVNVRRGRGRPKLTWGEAIKRDLKGWEIPRDMCFDRNAWKAAIDVPES |
| Ga0182221_10856561 | 3300017442 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGELKGWNIPKDLALDRSA |
| Ga0182221_11421201 | 3300017442 | Miscanthus Phyllosphere | RGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPKP |
| Ga0182193_10068953 | 3300017443 | Miscanthus Phyllosphere | RGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP |
| Ga0182193_10493981 | 3300017443 | Miscanthus Phyllosphere | QDSNVTRGRGRPKLTWVEAIKGDLKGWNIPKDLTLDRSAWKTTIHVPEP |
| Ga0182193_10792791 | 3300017443 | Miscanthus Phyllosphere | VKRGRGRPKLAWVEAIKADLKEWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182193_11453231 | 3300017443 | Miscanthus Phyllosphere | RGRPKLTWVEAIKGDLKGWNISKDLALDRSAWKTAIHVPEP |
| Ga0182198_10088441 | 3300017445 | Switchgrass Phyllosphere | NVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVHEP |
| Ga0182233_11110891 | 3300017680 | Miscanthus Phyllosphere | VKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTTIHVPEP |
| Ga0182229_10540741 | 3300017682 | Miscanthus Phyllosphere | SNMKRGRGRPKLTWIEAIKGDLKGWNIPKDLALDRSAWKIAIHVPEP |
| Ga0182229_10714721 | 3300017682 | Miscanthus Phyllosphere | MHSGILSQDSNMKRGRERPKLTWVEAIKGDLKGWNIPKNLALDRISFKISSHVPVP |
| Ga0182218_10054532 | 3300017683 | Miscanthus Phyllosphere | LTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVPEP |
| Ga0182218_10209401 | 3300017683 | Miscanthus Phyllosphere | VRSKILSQDSNVKRGRGRPKLTWVEAIKGDLKEWNIPKDLALDKSAWKTAIHVPET |
| Ga0182218_10224592 | 3300017683 | Miscanthus Phyllosphere | SNVKRGRGRPKLTWVETIKGDLKGWNIPKDLALDRSA |
| Ga0182218_10537131 | 3300017683 | Miscanthus Phyllosphere | DSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRNAWKTAIHVPEP |
| Ga0182218_10539751 | 3300017683 | Miscanthus Phyllosphere | ILSQDSNVKRGRGRPKLTWVEAIKGELKGWNIPKDLALDRSA |
| Ga0182218_10741521 | 3300017683 | Miscanthus Phyllosphere | KRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVSEP |
| Ga0182218_10779061 | 3300017683 | Miscanthus Phyllosphere | MSNGVRSGILSQDSNVKRGRGRPELTWIEAIKGDLKGWNISKELALHRSAWKTVIHVPEP |
| Ga0182218_10862421 | 3300017683 | Miscanthus Phyllosphere | SQDNNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSACKTAIHVSEP |
| Ga0182218_10895251 | 3300017683 | Miscanthus Phyllosphere | RPPEAPVRSGILSQDSNVKRGRGRPKLTWVEAIKEDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182218_11302582 | 3300017683 | Miscanthus Phyllosphere | LSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSASKTAIHVPEP |
| Ga0182225_10163952 | 3300017684 | Miscanthus Phyllosphere | GILSQDSNVKRGRGRPKLTWIETIKGDLKGWNIPKDLVLDRSAWKTAIHVPKP |
| Ga0182227_10413782 | 3300017685 | Miscanthus Phyllosphere | MKRGRGRPKLIWVEAIKGDLKGWNIPKDLALDRSAWKTIIHVPEP |
| Ga0182227_10689083 | 3300017685 | Miscanthus Phyllosphere | RSGIISQDSNVKRGRGRPKLTWVEVIKRDLKGWNISKDLALDRSAWKTAIHVLEP |
| Ga0182227_10847922 | 3300017685 | Miscanthus Phyllosphere | PKLTWIEAIKGDLKGWNIPKDLALDRSAWKTAIHVSEP |
| Ga0182227_10910391 | 3300017685 | Miscanthus Phyllosphere | EAPVHSGILRQDSNMKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182227_11310541 | 3300017685 | Miscanthus Phyllosphere | VVIVQRRPSEAPVHSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLAVDRSAWKTAIHVPKP |
| Ga0182205_11053192 | 3300017686 | Miscanthus Phyllosphere | VRSGILSQDSNVKRGRGRLKLTWVEAIKGDLKGWNIPKDLALDRSAWKTA |
| Ga0182205_11152291 | 3300017686 | Miscanthus Phyllosphere | VRSGILSQNSNVKRDRERPKLTWVEAIKEDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0182205_11453751 | 3300017686 | Miscanthus Phyllosphere | SQDSNVKRGRGRPKLTWVETIKGDLKGWNIPKDLALDRSDWKTIIHVPEP |
| Ga0182223_11122401 | 3300017690 | Miscanthus Phyllosphere | QDSNVKRGRGRLKLTWVEAIKGDLKGWNIPKDFVLDRSA |
| Ga0182223_11249761 | 3300017690 | Miscanthus Phyllosphere | ISQDSNVKRGRGRPKLIWVDAIKGDLNGWNIPKDLALDRSAWKSAIHVPEPLIVSAGFQL |
| Ga0182210_11442461 | 3300017692 | Switchgrass Phyllosphere | RGRPKLTWDEIIRRDLKDWSIATRDLSLDRSAWKTAIHVPEP |
| Ga0182216_10800842 | 3300017693 | Switchgrass Phyllosphere | PKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP |
| Ga0182216_10974521 | 3300017693 | Switchgrass Phyllosphere | VHSGIIRRNNDVKRGRGRPNLTWEEAVKRDLKDWNIMRELALDRAAWKAAIHVPEP |
| Ga0206356_101549551 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VHRGIIRRDNNVKRGRSRPNLTWEEAIKRDLKECNIPMEMRLDRSVWKEAIHVPEP |
| Ga0206348_1163661 | 3300020071 | Corn, Switchgrass And Miscanthus Rhizosphere | GIIRRPENVKRGRGRPTLTWTEAVKRDLKEWNIDKELAVDRKGWKCAIHVPEP |
| Ga0206349_15161752 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | VHIGIIRRPKNVKRGRGRPTLTWTEAVKRDLKEWNIDKELVVDRKGWKCVIHVPEP |
| Ga0206351_100124031 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | VHRGIIRRDNNVKRGRGRPNLTWEEAIKRGLKEWNIPMELCLDRSAWKEAIHVPEP |
| Ga0206351_105320461 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | PKLTWEEAKKGDLKGWNINKYLALNRSKCKIAIHMHES |
| Ga0206351_106200512 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | RPTLTWTEAVKRDLKEWNIDKELAVDRKGWKCAIHVPEP |
| Ga0206352_108178861 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | RPENVKRGRGRPTLTWTEAVKRDLKEWNIDKELVVDRKGWKCVIHVPEP |
| Ga0206350_104607771 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | IIRRPENVKRGRGRPTLTWTEAVKRDLKEWNIDKELAVDRKGWKCAIHVPEP |
| Ga0206353_104068992 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | RRDNNVKRGRGRPNLTWEEAIKRDLKEWNIPMELCLDRSAWKEAIHVPEP |
| Ga0206353_104116022 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VHIGIIRRPENVKRGRGRPTLTWTEAVKRDLKEWNIDKELVVDRKGWKCVIHVPEP |
| Ga0206353_111567762 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | RGRPTLTWTEAVKRDLKEWNIDKELAVDRKGWKCAIHVPEP |
| Ga0224712_106851202 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | ENVKRGRGRPTLTWTEAVKRDLKEWNIDKELAADKKGWKCAIHVPEP |
| Ga0207652_103164301 | 3300025921 | Corn Rhizosphere | MVWACPPETHRGTGAQRHHKTRQYVKRGRERPNLTWEEAIKRDLKEWNIPMELCLDRSAWKEAIHMPEL |
| Ga0207678_102036723 | 3300026067 | Corn Rhizosphere | MVWACPPETPEAPVHRGIIRRDNNVKRGRGRPNLTWEEAIKRDLKEWNIPMELCLDRSAWKEAIHVPEP |
| Ga0207698_111081192 | 3300026142 | Corn Rhizosphere | VRSGILSQDSNVKRGRGRPKLTWVEAIKGDLKGWNIPKDLALDRSAWKTAIHVPEP |
| Ga0268330_10040842 | 3300028056 | Phyllosphere | MHSGIIRRNNDVKRGRGRPNLTWEEAVKRDLKDWNIMRELALDRAAWKAAIHVPEP |
| Ga0268332_10450042 | 3300028058 | Phyllosphere | VCNEDLLRYLHSGIISWNNDVKRGRGRPKLTWEETVKRDLKDWNIMRELALDRAAWKAAIHVPEP |
| Ga0268342_10134711 | 3300028062 | Phyllosphere | VHSGIISRNNDVKRGRGRPKLTWEETVKRDLKDWNIMRELALDRAAWKAAIHVPEP |
| Ga0268336_10162521 | 3300028152 | Phyllosphere | VHSSIIRRNNEVKRGRGQPSLTWEEVVKRDLRDWNIMRELALDRAAWKAAIHVPEP |
| Ga0268324_10224132 | 3300028251 | Phyllosphere | LKHDGNMRKGRGRPKLTWEETIRRDLKDWSIPRDLSLDRSAWKAAIHVPEP |
| Ga0268310_10510231 | 3300028262 | Phyllosphere | VHSGIISRNNDVKRGRGRPKLTWEEIVKRDLKDWNIMRELALDKAAWKAAIHVPEP |
| Ga0268319_10122261 | 3300028473 | Phyllosphere | VHSGIISRNNDVKRGRGRPKLTWEETVKRDLKDWNIMRELALDKAAWKAAIHVPEP |
| Ga0308189_104826762 | 3300031058 | Soil | ADNVKRGRGRLNFTWEESVKRDLKAWSITKELAMDRGA |
| Ga0214493_10571141 | 3300032465 | Switchgrass Phyllosphere | PKLTWVESVKRDLMDWNISKEIALDRSAWRLAINVPEP |
| Ga0214493_11456802 | 3300032465 | Switchgrass Phyllosphere | VLERVDNVKRGRGRPKLTWDESVKRDLKDWNISNKIILDRSA |
| Ga0214482_10378431 | 3300032468 | Switchgrass Phyllosphere | KRGRGRPTLTWDELVKRDRKDWNISKEIALDRSAWRLAINVPEP |
| Ga0214490_10914921 | 3300032502 | Switchgrass Phyllosphere | ILKHDGNMRRGRGRPKLTWEKTIRRDLKDWSIPRVLSLDRSAWKAAILVPEP |
| Ga0214483_10861551 | 3300032548 | Switchgrass Phyllosphere | RGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVSEP |
| Ga0321340_10173141 | 3300032550 | Switchgrass Phyllosphere | LVDNVKRGRGRPKLTWVESVKRDLKDWNISKEIVLDRSDWRLAINVPEP |
| Ga0321339_10815481 | 3300032551 | Switchgrass Phyllosphere | VRNRVLERVDNVKRGRGRPKLTWVESVKRDLKDWNISKEIALDMSAWRLAIKVPEP |
| Ga0321339_11413891 | 3300032551 | Switchgrass Phyllosphere | KRGRGRPKLTWVESVKRDLKDWNISKEIGLDRSAWRLAINVSEP |
| Ga0321339_11504491 | 3300032551 | Switchgrass Phyllosphere | KRGRGRPNLTWEESLKRDLKDWNTQELAMDSGVWKLAIQVPEP |
| Ga0214500_10760072 | 3300032589 | Switchgrass Phyllosphere | VLERVDNVKRGRGRHKLTWDELVKRDLKDWSISKEIALDRST |
| Ga0214489_10084153 | 3300032590 | Switchgrass Phyllosphere | GRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP |
| Ga0214489_10412711 | 3300032590 | Switchgrass Phyllosphere | LLGVLERVDNVKRGIGRPKLTWDESVKRDLKDWNISKEIA |
| Ga0214484_11116351 | 3300032591 | Switchgrass Phyllosphere | VRNGVLERVDNVKRGRGRPKLTWDELVKRDLKDWNISKEIALDRSAWKLAINVPEP |
| Ga0214504_11054881 | 3300032592 | Switchgrass Phyllosphere | LNVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRSAWRLA |
| Ga0214497_10715731 | 3300032689 | Switchgrass Phyllosphere | VKRDRGRPKLTWDELVKRYLKVWNISKEIALDRSAWKLAINVPEP |
| Ga0214499_11732702 | 3300032697 | Switchgrass Phyllosphere | GVLEPVDNVKRGRGRPKLTWVESVRRDLKDWNISKEIALDRSAWRQAINVSEP |
| Ga0214499_11998621 | 3300032697 | Switchgrass Phyllosphere | NVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP |
| Ga0214499_12734822 | 3300032697 | Switchgrass Phyllosphere | DNVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP |
| Ga0314720_10256133 | 3300032759 | Switchgrass Phyllosphere | GRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP |
| Ga0314720_10422131 | 3300032759 | Switchgrass Phyllosphere | MLFFSPWGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVP |
| Ga0314748_10921912 | 3300032791 | Switchgrass Phyllosphere | VKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSACRLAINVPEP |
| Ga0314744_10596021 | 3300032792 | Switchgrass Phyllosphere | VKRGRGRPKLTWIESVKRDLKDWNISKEIALDRSAWRLAINVPEP |
| Ga0314745_10412822 | 3300032812 | Switchgrass Phyllosphere | LERVDNVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRSV |
| Ga0314745_10587481 | 3300032812 | Switchgrass Phyllosphere | RVDNVKRGRGRPKLTWDESVKRDLKDWNISKDIALDRSA |
| Ga0314732_1016201 | 3300032826 | Switchgrass Phyllosphere | VQRRPPDAPVHSGIIRRNNDVKRGRGRPILTWKEVVKRDLKDWNITREIALDRATWKAAIHVPEP |
| Ga0314743_11282772 | 3300032844 | Switchgrass Phyllosphere | ERVDNVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRSA |
| Ga0307417_103474061 | 3300033291 | Salt Marsh | QRRPAEALVRSGEIRRSGNEKRGRGRPNLTWEESVKRDLKDWCITKELALDKREWKLAIHVPEP |
| Ga0314768_13359631 | 3300033523 | Switchgrass Phyllosphere | LVDNVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP |
| Ga0314758_10904811 | 3300033525 | Switchgrass Phyllosphere | LITVYSVKRGRGRPKLTWDESVKRDLKDWNISKEIALDR |
| Ga0314761_10564751 | 3300033526 | Switchgrass Phyllosphere | NVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVLEP |
| Ga0314767_11124542 | 3300033532 | Switchgrass Phyllosphere | VKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLAINVPEP |
| Ga0314767_11831821 | 3300033532 | Switchgrass Phyllosphere | LLNVKRGRGRPKLTWDESVKRDLKDWNISKEIALDR |
| Ga0314755_11355631 | 3300033538 | Switchgrass Phyllosphere | DNVKRGRGRPKLTWVESVKRDLKDWNISKEIALDRSAWRLPINVPEP |
| Ga0314769_12475821 | 3300033542 | Switchgrass Phyllosphere | NVKRGRGRPKLTWDESVKRDLKDWNISKEIALDRSA |
| ⦗Top⦘ |