Metagenome / Metatranscriptome Family F100243

Overview

Basic Information

• Family ID: F100243
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 102
• Average Sequence Length: 37 residues
• Representative Sequence: LKASREILVPRADVVSDSVLARKCVPPHGTAVVGGKW
• Number of Associated Samples: 72
• Number of Associated Scaffolds: 102

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Eukaryota
• % of genes with valid RBS motifs: 72.55 %
• % of genes near scaffold ends (potentially truncated): 42.16 %
• % of genes from short scaffolds (< 2000 bps): 95.10 %
• Associated GOLD sequencing projects: 72
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Eukaryota (67.647 % of family members)
• NCBI Taxonomy ID: 2759
• Taxonomy: All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (68.627 % of family members)
• Environment Ontology (ENVO): Unclassified (85.294 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (74.510 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 0.00%
  β-sheet: 0.00%
  Coil/Unstructured: 100.00%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 102 Family Scaffolds
PF03732	Retrotrans_gag	0.98
PF00665	rve	0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 102 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.98
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.98
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.98
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.98

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	67.65 %
Unclassified	root	N/A	32.35 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	67.65 %
Unclassified	root	N/A	32.35 %

Level 3

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	67.65 %
Unclassified	root	N/A	32.35 %

Level 4

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	67.65 %
Unclassified	root	N/A	32.35 %

Level 5

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	67.65 %
Unclassified	root	N/A	32.35 %

Level 6

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	67.65 %
Unclassified	root	N/A	32.35 %

Level 7

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	67.65 %
Unclassified	root	N/A	32.35 %

Level 8

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	67.65 %
Unclassified	root	N/A	32.35 %

Level 9

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	67.65 %
Unclassified	root	N/A	32.35 %

Level 10

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	67.65 %
Unclassified	root	N/A	32.35 %

Level 11

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	67.65 %
Unclassified	root	N/A	32.35 %

Level 12

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	67.65 %
Unclassified	root	N/A	32.35 %

Level 13

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	67.65 %
Unclassified	root	N/A	32.35 %

Level 14

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	67.65 %
Unclassified	root	N/A	32.35 %

Level 15

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	67.65 %
Unclassified	root	N/A	32.35 %

Level 16

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	67.65 %
Unclassified	root	N/A	32.35 %

Level 17

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	67.65 %
Unclassified	root	N/A	32.35 %

Level 18

Name	Rank	Taxonomy	Distribution
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	65.69 %
Unclassified	root	N/A	32.35 %

Level 19

Name	Rank	Taxonomy	Distribution
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	65.69 %
Unclassified	root	N/A	32.35 %

Level 20

Name	Rank	Taxonomy	Distribution
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	65.69 %
Unclassified	root	N/A	32.35 %

Level 21

Name	Rank	Taxonomy	Distribution
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	65.69 %
Unclassified	root	N/A	32.35 %

Level 22

Name	Rank	Taxonomy	Distribution
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	63.73 %
Unclassified	root	N/A	32.35 %
Dichantheliinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae	1.96 %

Level 23

Name	Rank	Taxonomy	Distribution
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	63.73 %
Unclassified	root	N/A	32.35 %
Dichanthelium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium	1.96 %

Level 24

Name	Rank	Taxonomy	Distribution
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	59.80 %
Unclassified	root	N/A	32.35 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	1.96 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	1.96 %

Level 25

Name	Rank	Taxonomy	Distribution
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	59.80 %
Unclassified	root	N/A	32.35 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1.96 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	1.96 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005719|Ga0068861_100456024	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1147
3300009177|Ga0105248_10610702	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1230
3300009972|Ga0105137_102561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	765
3300009973|Ga0105136_103727	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	800
3300009973|Ga0105136_107855	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	629
3300009981|Ga0105133_114328	Not Available	644
3300009981|Ga0105133_116472	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	619
3300009981|Ga0105133_125034	Not Available	547
3300009987|Ga0105030_117956	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	635
3300009989|Ga0105131_138216	Not Available	530
3300009989|Ga0105131_140828	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	517
3300009990|Ga0105132_119530	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	658
3300010371|Ga0134125_11887645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	649
3300010396|Ga0134126_12828610	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	526
3300010396|Ga0134126_12951472	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	514
3300010399|Ga0134127_13370216	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	523
3300010403|Ga0134123_10651930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1021
3300012949|Ga0153798_10212798	Not Available	684
3300013306|Ga0163162_12660895	Not Available	576
3300013306|Ga0163162_13270931	Not Available	519
3300014325|Ga0163163_11823207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	669
3300014326|Ga0157380_10920019	Not Available	902
3300015270|Ga0182183_1086443	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	519
3300015280|Ga0182100_1009067	Not Available	1059
3300015280|Ga0182100_1019932	Not Available	848
3300015290|Ga0182105_1008986	Not Available	1095
3300015290|Ga0182105_1068245	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	594
3300015293|Ga0182103_1081123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	548
3300015297|Ga0182104_1053341	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	671
3300015297|Ga0182104_1088985	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	563
3300015301|Ga0182184_1047144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	653
3300015309|Ga0182098_1038133	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	760
3300015309|Ga0182098_1116485	Not Available	521
3300015311|Ga0182182_1078356	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	592
3300015312|Ga0182168_1032765	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	844
3300015312|Ga0182168_1058078	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	696
3300015313|Ga0182164_1119051	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	532
3300015315|Ga0182120_1009102	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1247
3300015315|Ga0182120_1082472	Not Available	617
3300015316|Ga0182121_1123335	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	540
3300015318|Ga0182181_1080522	Not Available	572
3300015319|Ga0182130_1092841	Not Available	583
3300015327|Ga0182114_1094009	Not Available	630
3300015328|Ga0182153_1113832	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	566
3300015330|Ga0182152_1063688	Not Available	710
3300015331|Ga0182131_1075423	Not Available	670
3300015331|Ga0182131_1145480	Not Available	517
3300015332|Ga0182117_1125668	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	573
3300015332|Ga0182117_1141862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	544
3300015336|Ga0182150_1023145	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1021
3300015336|Ga0182150_1162332	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	508
3300015338|Ga0182137_1154816	Not Available	536
3300015338|Ga0182137_1172899	Not Available	510
3300015340|Ga0182133_1151281	Not Available	559
3300015340|Ga0182133_1168736	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	532
3300015340|Ga0182133_1175397	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	523
3300015348|Ga0182115_1001542	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	3307
3300015349|Ga0182185_1151807	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	690
3300015350|Ga0182163_1086808	Not Available	936
3300015350|Ga0182163_1143340	Not Available	741
3300015350|Ga0182163_1233786	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	576
3300015350|Ga0182163_1280054	Not Available	522
3300015350|Ga0182163_1288252	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	514
3300015352|Ga0182169_1211780	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	633
3300015353|Ga0182179_1180765	Not Available	666
3300015353|Ga0182179_1239643	Not Available	583
3300015353|Ga0182179_1288304	Not Available	533
3300015354|Ga0182167_1285594	Not Available	588
3300017408|Ga0182197_1078329	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	647
3300017412|Ga0182199_1034777	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	965
3300017412|Ga0182199_1091591	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	687
3300017412|Ga0182199_1118379	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	624
3300017414|Ga0182195_1089131	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	722
3300017421|Ga0182213_1073646	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	939
3300017421|Ga0182213_1143434	Not Available	671
3300017422|Ga0182201_1127726	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	525
3300017445|Ga0182198_1189590	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	517
3300017447|Ga0182215_1080805	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	712
3300017447|Ga0182215_1107370	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	625
3300017693|Ga0182216_1105485	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	679
3300017792|Ga0163161_11213244	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	653
3300020031|Ga0182119_101146	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	861
3300022465|Ga0213505_104054	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1204
3300025918|Ga0207662_11230438	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	532
3300025931|Ga0207644_11551883	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	556
3300025972|Ga0207668_10962623	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	762
3300028050|Ga0268328_1060342	Not Available	537
3300028058|Ga0268332_1078983	Not Available	503
3300028253|Ga0268316_1015341	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	585
3300028253|Ga0268316_1016050	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	577
3300028256|Ga0268304_1015189	Not Available	510
3300028262|Ga0268310_1020900	Not Available	682
3300032464|Ga0214492_1000483	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	3736
3300032464|Ga0214492_1021876	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1191
3300032591|Ga0214484_1005259	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	2040
3300032697|Ga0214499_1218494	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	589
3300032699|Ga0214494_1000856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	3186
3300032759|Ga0314720_1011178	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	1080
3300032812|Ga0314745_1001777	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	2975
3300032822|Ga0314740_1004177	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1754
3300032827|Ga0314730_104583	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1392
3300032918|Ga0314726_115862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	852

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	93.14%
Environmental	Environmental	5.88%
Engineered	Engineered	0.98%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	93.14%
Terrestrial	Environmental → Terrestrial	5.88%
Bioreactor	Engineered → Bioreactor	0.98%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	74.51%
Unclassified	Host-Associated → Plants → Unclassified	8.82%
Soil	Environmental → Terrestrial → Soil	5.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.90%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.92%
Roots	Host-Associated → Plants → Roots	0.98%
Unclassified	Engineered → Bioreactor → Unclassified	0.98%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	74.51%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	8.82%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	4.90%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.94%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.96%
Loam	Environmental → Terrestrial → Soil → Loam	0.98%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.98%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.98%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	74.51%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	8.82%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	4.90%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.98%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.98%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.98%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	68.63%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	8.82%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	5.88%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.90%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.96%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.98%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.98%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated
3300009973	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG	Host-Associated
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated
3300009987	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG	Host-Associated
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300012949	Switchgrass enrichment cultures co-assembly	Engineered
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300020031	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG	Host-Associated
3300022465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome)	Host-Associated
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated
3300032464	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032591	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032699	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032759	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032822	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032827	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032918	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068861_1004560241	3300005719	Switchgrass Rhizosphere	LKASREILVPRADVVSDSVLARKCVPPHGTAVVGGKW*
Ga0105248_106107021	3300009177	Switchgrass Rhizosphere	LKASREILVPRADMVSDSVLARKCVPPHGTAVVGGKW*
Ga0105137_1025611	3300009972	Switchgrass Associated	LKASREILVLRADVVSDSVLARKCVPPHGTVVVGGKW*
Ga0105136_1037271	3300009973	Switchgrass Associated	LKASREILVPRADVVSDSVLDRKCVPPHGTAVVGGKW*
Ga0105136_1078551	3300009973	Switchgrass Associated	LKVSREILVPRADVVSDSVLARKCVPPHGTAVVGGKW*
Ga0105133_1143281	3300009981	Switchgrass Associated	LLKPSREILVSRADVVSDSVLPRKCVPPHGTPVVGGKW*
Ga0105133_1164721	3300009981	Switchgrass Associated	LKASIEILVPRADTVSDSVLARKCVPPHGTTVVGGRW*
Ga0105133_1250341	3300009981	Switchgrass Associated	ASREILVSRANVVSDSVLARKCVPPHGTVVVGGKW*
Ga0105030_1179561	3300009987	Switchgrass Rhizosphere	LKASREILVPRANVVSDSVLARKCVPPHGTTVVGGKW*
Ga0105131_1382161	3300009989	Switchgrass Associated	SREILVPRADVVSDSVLARKCVPPHGTAVVGGKW*
Ga0105131_1408281	3300009989	Switchgrass Associated	LKASREILVPRADVVPDSVLARKCVPPHGTTVVGGK
Ga0105132_1195301	3300009990	Switchgrass Associated	LKASREILVPRADVVSDLVLARKCVPPYGTAVVGGKW*
Ga0134125_118876451	3300010371	Terrestrial Soil	LKASREILVSRADVVSDSVLARKCVPPHGTAVVGGSGDSLVRPS*
Ga0134126_128286101	3300010396	Terrestrial Soil	LKASREILVPRADVVSDTVLARKCVPPHGTAVVGGKW*
Ga0134126_129514721	3300010396	Terrestrial Soil	LKASREIQVLRADVVSDSVLARKCVPPHDTAVVGGK
Ga0134127_133702161	3300010399	Terrestrial Soil	LKASREILVPRADVVSDLVLARKCVPPYGAVVVGGKW*
Ga0134123_106519301	3300010403	Terrestrial Soil	LKASREILVPRADVVSDSVLARKCVPPRGTAVVGGKW*
Ga0153798_102127982	3300012949	Switchgrass Degrading	GFLLKASKEILVPRANVVSDSVPARKCVPPHGTIVVGGKW*
Ga0163162_126608951	3300013306	Switchgrass Rhizosphere	LKASSEILVPRADMVSDSVLARKCVPPHGTAVVGGKW
Ga0163162_132709311	3300013306	Switchgrass Rhizosphere	LKASREILVPRADVVPDSVLARKYVPPHGTAMVGGKW*
Ga0163163_118232071	3300014325	Switchgrass Rhizosphere	LKVSREILVSRADVVSDSVLARKCVPPHGTAVVGGKW*
Ga0157380_109200192	3300014326	Switchgrass Rhizosphere	LKASREILVSRADVVSDSVLARKCVPPHGTAVVGGK
Ga0182183_10864431	3300015270	Switchgrass Phyllosphere	LKASREILVLRADVVSDSVLARKCVPPHGTAVVGGKW*
Ga0182100_10090671	3300015280	Switchgrass Phyllosphere	LKALRDILVPRADVVSDSMLARKCVPPYGTAVVGDKW*
Ga0182100_10199321	3300015280	Switchgrass Phyllosphere	LKASTEILVPRADVMSNSMLARKFVPHHGTTVVGGKW*
Ga0182105_10089861	3300015290	Switchgrass Phyllosphere	LKASREILVPRADMVSDSMLARKCVPPHGTAVVGDEW*
Ga0182105_10682451	3300015290	Switchgrass Phyllosphere	LKASREILVPRADVVSDLVLARKCVPPHDTAVVGGKW*
Ga0182103_10811231	3300015293	Switchgrass Phyllosphere	LKESREILALRADVVSDLVLAKKCLPPYGTAVVVDNW*
Ga0182104_10533411	3300015297	Switchgrass Phyllosphere	LKASREILVPRADVVSDLVLARKCVPPHGTAVVGGKW*
Ga0182104_10889851	3300015297	Switchgrass Phyllosphere	LKASREILVPRADMVSDSVLSGRCVPPHGTVVVGG
Ga0182184_10471441	3300015301	Switchgrass Phyllosphere	LKASIEILVPRADVVSDSVLARKCVPLYGTAVVGGKW*
Ga0182098_10381331	3300015309	Switchgrass Phyllosphere	LKASRGILVPRADVVSDSVLARKCVPPHGTAVVVGKW*
Ga0182098_11164851	3300015309	Switchgrass Phyllosphere	LKASREILVTRANVVSILVLARKCIPLHDITVVVGKW*
Ga0182182_10783561	3300015311	Switchgrass Phyllosphere	LKASIEILVPRADVASDSVLARKCVPLYGTAVVGGKW*
Ga0182168_10327651	3300015312	Switchgrass Phyllosphere	LKASREILVLRADVVSDSVLARKCVSSHSITVVVGKW*
Ga0182168_10580781	3300015312	Switchgrass Phyllosphere	LKVSREILVPREDVVSDLVLARKCVPPHGTPVVGGKW*
Ga0182164_11190511	3300015313	Switchgrass Phyllosphere	LKASKEILLPRADMVSDSVLARKCVPPHGTTVVGGKW
Ga0182120_10091022	3300015315	Switchgrass Phyllosphere	LKASREILVPIADVVSDSVLARKCVPPHGAAVVGGK
Ga0182120_10824722	3300015315	Switchgrass Phyllosphere	LLKASREILVLRADVMSDSVLARKCVPPHGTVVVGSMW*
Ga0182121_11233351	3300015316	Switchgrass Phyllosphere	LKASREILVPRADVVSDSVLARKCVPPHGTTVVGGKW*
Ga0182181_10805221	3300015318	Switchgrass Phyllosphere	LKALREILVPRADAVSDSVLARKFVPSHGTAVVGGKR*
Ga0182130_10928411	3300015319	Switchgrass Phyllosphere	KASREILVSSADVVSDLVLARECVPPHGTVVVGGRW*
Ga0182114_10940091	3300015327	Switchgrass Phyllosphere	ASIEILVPRADIVSDSVLARKCVPPHGTTVVGGKW*
Ga0182153_11138321	3300015328	Switchgrass Phyllosphere	LKASRDILVPRAAVVPDSVLARKCVPPHGTAVVVGKW*
Ga0182152_10636881	3300015330	Switchgrass Phyllosphere	LKASREILVPRADVMSDSVLARKYVPPHGTAVVGSKW*
Ga0182131_10754231	3300015331	Switchgrass Phyllosphere	RPLREILIPRVDEVSDSVLSRKCVPPHGNAVVGVNW*
Ga0182131_11454801	3300015331	Switchgrass Phyllosphere	SREILVPRADVVSDSVLARKCVPPHGTAVVGDKW*
Ga0182117_11256681	3300015332	Switchgrass Phyllosphere	LKATREILVPRADMVSDSVIARKCVPPHGTAMVGGKW*
Ga0182117_11418621	3300015332	Switchgrass Phyllosphere	LKASREILVPRTDVVSDSVLARKCVPPHGTAVVGGKW*
Ga0182150_10231451	3300015336	Switchgrass Phyllosphere	LKASREILVPRVDVVSDSVLARKCVTPHGTTVVGGKW*
Ga0182150_11623321	3300015336	Switchgrass Phyllosphere	LKALREILVLRADVVSDLVLARKCVPPHGTAVVGGKW
Ga0182137_11548161	3300015338	Switchgrass Phyllosphere	VEGPSREILVPSANVVSDLVLARKCVPPHGTAVVVSKW*
Ga0182137_11728991	3300015338	Switchgrass Phyllosphere	ASREILVSRADVVSDSVLARKCVPPHGIIVVGGKW*
Ga0182133_11512811	3300015340	Switchgrass Phyllosphere	FLLKASREILVPRADVASNSVLARKCVPPHSTAVVGGKW*
Ga0182133_11687361	3300015340	Switchgrass Phyllosphere	LKASREILVPRADVVSESVLARKCVPPHGTVVVGGKW
Ga0182133_11753971	3300015340	Switchgrass Phyllosphere	LKASREILVLRADVVSDSVLARKSVPPHGTAVVGGKW*
Ga0182115_10015423	3300015348	Switchgrass Phyllosphere	LKASREILVSRTDVVSNSVLARKCVPPHSTAVGGGKW*
Ga0182185_11518071	3300015349	Switchgrass Phyllosphere	LKVSREILVPRADVVSDSMLAIKCVPTHDTTVVGGKW*
Ga0182163_10868081	3300015350	Switchgrass Phyllosphere	ASREILTPRLDVVSNLVLARKCVPPHVTVVVVGKW*
Ga0182163_11433401	3300015350	Switchgrass Phyllosphere	LKASREILVPRADVVFDSVLARKYVPPHGTAVVVGKW*
Ga0182163_12337861	3300015350	Switchgrass Phyllosphere	LKVSREILVSRADVVSDSVLARKCVPPHGIAAVGGKW*
Ga0182163_12800541	3300015350	Switchgrass Phyllosphere	FLLKASREILALRVDVVSDLVLAKKCLPPHGTAVVVDNW*
Ga0182163_12882521	3300015350	Switchgrass Phyllosphere	LKASREILVSRTDVVSDSVLARKSVPPHGTAVVGGKW*
Ga0182169_12117801	3300015352	Switchgrass Phyllosphere	LKASREILVPSADMVSDLVLDRKCVLPHGTAVVVGKC
Ga0182179_11807651	3300015353	Switchgrass Phyllosphere	LKASREILVSRADVVSDSVLARKCVPTHGTAVVGG*
Ga0182179_12396432	3300015353	Switchgrass Phyllosphere	LLKASREILVPRADVVSDSVLAKKCVTPHGTAVVVCKW*
Ga0182179_12883041	3300015353	Switchgrass Phyllosphere	SREILVPRADMVSDSFLARKCVPPHGTTVVGGKW*
Ga0182167_12855941	3300015354	Switchgrass Phyllosphere	LKATREILTLCAYMVSSLALSRKCVPPHGTVVVGN
Ga0182197_10783291	3300017408	Switchgrass Phyllosphere	LKASREILVSRADVVSDSVLARKCVPPHGIIVVGGK
Ga0182199_10347771	3300017412	Switchgrass Phyllosphere	LKASREILVPRADVVSDSVLARKCVPPHGTVVVGGKW
Ga0182199_10915911	3300017412	Switchgrass Phyllosphere	LKASREILVLRANVVSDSVLARKCVPPHGTAVVGGKWR
Ga0182199_11183791	3300017412	Switchgrass Phyllosphere	LNASREILVPSVDVVSDLVLARKCVPPHGTTVVVGKW
Ga0182195_10891311	3300017414	Switchgrass Phyllosphere	KASREILVPRADVVSDSVLARKCVPPHSTAVVGGKW
Ga0182213_10736461	3300017421	Switchgrass Phyllosphere	LKASREILVPRVDMVSDSVLARKCVPPHGTAVVGGKW
Ga0182213_11434341	3300017421	Switchgrass Phyllosphere	GGFLLKASREILVSRADVVSDLVQARKCVPPHVTAVVGGKW
Ga0182201_11277261	3300017422	Switchgrass Phyllosphere	GGFLLKASREILIPRVDVVPDSVLARKCVPPHGTAVVGGKW
Ga0182198_11895901	3300017445	Switchgrass Phyllosphere	LKASREILVLRANVVSDSVLARKCVPPHGTVVVGGKW
Ga0182215_10808051	3300017447	Switchgrass Phyllosphere	LKGSIEILVSRADMVSDSILARKCVPPHGTAVVGG
Ga0182215_11073701	3300017447	Switchgrass Phyllosphere	LKASREILVLRADVVSDLVLARKCVPPHNTTVLGGKW
Ga0182216_11054851	3300017693	Switchgrass Phyllosphere	LKASREILVLRADVVSDSVLARKSVPPHGTAVVGGKW
Ga0163161_112132441	3300017792	Switchgrass Rhizosphere	LKASREILVSRADVVSDSVLARKCVSPHGNAVVGGKW
Ga0182119_1011461	3300020031	Switchgrass Phyllosphere	LKASREILVPRADVVSDSVLARKCVPPHGTAVVGGKW
Ga0213505_1040541	3300022465	Switchgrass Phyllosphere	LKASIEILVPRADTVSDSVLARKCVPPHGTAVVGGKW
Ga0207662_112304381	3300025918	Switchgrass Rhizosphere	LKASREILVPRIAVVSGSVLARKCVPPHGTTVVGGKW
Ga0207644_115518831	3300025931	Switchgrass Rhizosphere	LKASREILVPREDVVSDSVLARKCVPPHGTAVAGGK
Ga0207668_109626231	3300025972	Switchgrass Rhizosphere	LKASREILVPRADVVSDSVIARKYVPPHGTAVVGGKW
Ga0268328_10603421	3300028050	Phyllosphere	MKASREILVPRADVMSDSVLTRKCVPLHGTVVVGGKW
Ga0268332_10789831	3300028058	Phyllosphere	ASREILILRADVVSDSVLARKCVPPHGTAVVGGKW
Ga0268316_10153411	3300028253	Phyllosphere	LKASREILVSRADVVFDSVLARKCVPPHGTAVEGGKW
Ga0268316_10160501	3300028253	Phyllosphere	LKASREILILRVDVVSDSVLARKCVPPHGTVVVGGKW
Ga0268304_10151891	3300028256	Phyllosphere	LKASREILVSRADMVSDSVLVRKCVPPHGTAVVGGSGDS
Ga0268310_10209001	3300028262	Phyllosphere	LKASREILVSRADVVSDSVLARKCVPPHGTAVVGGKW
Ga0214492_10004831	3300032464	Switchgrass Phyllosphere	LKASIEILVPRADTVSDSVLARKCVPPHGTTVVGGKW
Ga0214492_10218761	3300032464	Switchgrass Phyllosphere	LKASKEILVPRADVVSDSVLARKCVPPHGTAVVGGKW
Ga0214484_10052591	3300032591	Switchgrass Phyllosphere	LKASKEILVPRADVVSDSVLARKCVPPHGTVVVGGKW
Ga0214499_12184941	3300032697	Switchgrass Phyllosphere	LKASREILVPRADVMSDSVLTRKCVPLHGTIVVGGKW
Ga0214494_10008565	3300032699	Switchgrass Phyllosphere	GRLRGFLLKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGKW
Ga0314720_10111783	3300032759	Switchgrass Phyllosphere	SFGRLRGFLLKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGKW
Ga0314745_10017774	3300032812	Switchgrass Phyllosphere	LKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGK
Ga0314740_10041771	3300032822	Switchgrass Phyllosphere	LKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGKW
Ga0314730_1045831	3300032827	Switchgrass Phyllosphere	LKASIEILVPRADVVSDSVLARKCVPPHGTAVVGGKW
Ga0314726_1158621	3300032918	Switchgrass Phyllosphere	GFLLKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGKW