NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065810

Metagenome / Metatranscriptome Family F065810

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065810
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 109 residues
Representative Sequence LNSFRNKYIYYAIDDILYLLKSNPVERDNLLAILYSQVLSLQNNLSVNFFDIWIHEIYINEISKVNKFLTNDSQNFEQFTYITIKLLYKTRIPIKKPESLW
Number of Associated Samples 106
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.83 %
% of genes near scaffold ends (potentially truncated) 90.55 %
% of genes from short scaffolds (< 2000 bps) 85.83 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (63.780 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(17.323 % of family members)
Environment Ontology (ENVO) Unclassified
(25.984 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(49.606 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.23%    β-sheet: 22.48%    Coil/Unstructured: 47.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF00237Ribosomal_L22 61.42
PF07650KH_2 6.30
PF00252Ribosomal_L16 5.51
PF00203Ribosomal_S19 2.36
PF00673Ribosomal_L5_C 1.57
PF03947Ribosomal_L2_C 0.79
PF00831Ribosomal_L29 0.79
PF00410Ribosomal_S8 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG0091Ribosomal protein L22Translation, ribosomal structure and biogenesis [J] 61.42
COG0197Ribosomal protein L16/L10AETranslation, ribosomal structure and biogenesis [J] 5.51
COG0185Ribosomal protein S19Translation, ribosomal structure and biogenesis [J] 2.36
COG0094Ribosomal protein L5Translation, ribosomal structure and biogenesis [J] 1.57
COG0090Ribosomal protein L2Translation, ribosomal structure and biogenesis [J] 0.79
COG0096Ribosomal protein S8Translation, ribosomal structure and biogenesis [J] 0.79
COG0255Ribosomal protein L29Translation, ribosomal structure and biogenesis [J] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.28 %
UnclassifiedrootN/A4.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000236|TB_FS08_3DRAFT_1045100All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae637Open in IMG/M
3300003554|Ga0008451J51688_136461All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta561Open in IMG/M
3300003882|Ga0063280_1065398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2372Open in IMG/M
3300004001|Ga0055450_10041262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1557Open in IMG/M
3300005824|Ga0074474_1177739All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta502Open in IMG/M
3300005824|Ga0074474_1211924All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta682Open in IMG/M
3300005824|Ga0074474_1324712All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta650Open in IMG/M
3300005824|Ga0074474_1549537All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300005824|Ga0074474_1598615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1422Open in IMG/M
3300005825|Ga0074476_1286161All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta552Open in IMG/M
3300005826|Ga0074477_1501075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales925Open in IMG/M
3300005827|Ga0074478_1913115All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta560Open in IMG/M
3300005829|Ga0074479_10419455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1133Open in IMG/M
3300005830|Ga0074473_10253447All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta869Open in IMG/M
3300005830|Ga0074473_10722092All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta946Open in IMG/M
3300005833|Ga0074472_10015428All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta735Open in IMG/M
3300005833|Ga0074472_10897560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2477Open in IMG/M
3300006379|Ga0075513_1326191All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta713Open in IMG/M
3300007239|Ga0075171_1425439All Organisms → cellular organisms → Eukaryota → Sar500Open in IMG/M
3300007244|Ga0075167_10743401All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta505Open in IMG/M
3300007521|Ga0105044_10276890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1611Open in IMG/M
3300007692|Ga0102823_1191845All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta545Open in IMG/M
3300007725|Ga0102951_1001726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7944Open in IMG/M
3300007955|Ga0105740_1029251All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens804Open in IMG/M
3300008020|Ga0100398_1175018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1046Open in IMG/M
3300008117|Ga0114351_1057068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2415Open in IMG/M
3300009024|Ga0102811_1191033All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta765Open in IMG/M
3300009026|Ga0102829_1087883All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta961Open in IMG/M
3300009026|Ga0102829_1319391All Organisms → cellular organisms → Eukaryota → Sar519Open in IMG/M
3300009027|Ga0102957_1034407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1732Open in IMG/M
3300009080|Ga0102815_10640168All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta599Open in IMG/M
3300009086|Ga0102812_10478887All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta679Open in IMG/M
3300009179|Ga0115028_11704551All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta544Open in IMG/M
3300009436|Ga0115008_10528764All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens844Open in IMG/M
3300009527|Ga0114942_1178062All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta757Open in IMG/M
3300009599|Ga0115103_1784293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1885Open in IMG/M
3300009608|Ga0115100_10077882All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta698Open in IMG/M
3300010412|Ga0136852_11657047All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta605Open in IMG/M
3300010990|Ga0139325_103413All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta679Open in IMG/M
3300012037|Ga0136559_1071062All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta913Open in IMG/M
3300012416|Ga0138259_1750865All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta679Open in IMG/M
3300012968|Ga0129337_1312970All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta815Open in IMG/M
3300013759|Ga0119972_1088821All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta536Open in IMG/M
(restricted) 3300014720|Ga0172376_10282809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1000Open in IMG/M
3300018605|Ga0193339_1012172All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta806Open in IMG/M
3300018704|Ga0192954_1015175All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta914Open in IMG/M
3300018704|Ga0192954_1015193All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta914Open in IMG/M
3300018792|Ga0192956_1150607All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta507Open in IMG/M
3300018934|Ga0193552_10020583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1427Open in IMG/M
3300019031|Ga0193516_10047558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1415Open in IMG/M
3300019037|Ga0192886_10309887All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta525Open in IMG/M
3300019049|Ga0193082_10375374All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta764Open in IMG/M
3300019053|Ga0193356_10244086All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens634Open in IMG/M
3300019129|Ga0193436_1057346All Organisms → cellular organisms → Eukaryota → Sar600Open in IMG/M
3300019736|Ga0194019_1032911All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta677Open in IMG/M
3300019739|Ga0194012_1026154All Organisms → cellular organisms → Eukaryota → Sar708Open in IMG/M
3300020160|Ga0211733_10464569All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens615Open in IMG/M
3300020177|Ga0181596_10219502All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta815Open in IMG/M
3300020183|Ga0194115_10096151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1669Open in IMG/M
3300020196|Ga0194124_10073978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2024Open in IMG/M
3300020603|Ga0194126_10188855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1494Open in IMG/M
3300021267|Ga0210353_143114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1689Open in IMG/M
3300021274|Ga0210327_114554All Organisms → cellular organisms → Bacteria10783Open in IMG/M
3300021276|Ga0210354_1118066All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta804Open in IMG/M
3300021277|Ga0210352_149032All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta888Open in IMG/M
3300021297|Ga0210369_1049074All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta586Open in IMG/M
3300021298|Ga0210349_1089314All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta589Open in IMG/M
3300021305|Ga0210296_1004650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1528Open in IMG/M
3300021309|Ga0210326_1100949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1159Open in IMG/M
3300021329|Ga0210362_1317356All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta542Open in IMG/M
3300021337|Ga0210341_1065051All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta936Open in IMG/M
3300021364|Ga0213859_10461006All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta556Open in IMG/M
3300021424|Ga0194117_10218715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria932Open in IMG/M
3300021846|Ga0210359_160270All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta532Open in IMG/M
3300021852|Ga0210317_1172082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6565Open in IMG/M
3300022144|Ga0213855_1035243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1348Open in IMG/M
3300022171|Ga0213857_1039819All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta574Open in IMG/M
3300025684|Ga0209652_1147028All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta623Open in IMG/M
3300026123|Ga0209955_1064630All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta714Open in IMG/M
3300026130|Ga0209961_1007626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales2699Open in IMG/M
3300027091|Ga0209873_1027807All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta676Open in IMG/M
3300027525|Ga0208437_1051415All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta990Open in IMG/M
3300027673|Ga0209278_1048317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1561Open in IMG/M
3300027757|Ga0208671_10026185All Organisms → cellular organisms → Bacteria2185Open in IMG/M
3300027789|Ga0209174_10289187All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta719Open in IMG/M
3300027849|Ga0209712_10820813All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta507Open in IMG/M
3300028420|Ga0210366_10369830All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta591Open in IMG/M
3300028598|Ga0265306_10578801All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta618Open in IMG/M
3300028600|Ga0265303_10538241All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta942Open in IMG/M
3300028600|Ga0265303_11540340All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta555Open in IMG/M
3300028645|Ga0302158_1024151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria913Open in IMG/M
3300028763|Ga0302204_1078332All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens649Open in IMG/M
3300029923|Ga0311347_10564479All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens692Open in IMG/M
3300029983|Ga0302284_1172246All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta624Open in IMG/M
3300030000|Ga0311337_11703077All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta553Open in IMG/M
3300031222|Ga0307972_1114129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1051Open in IMG/M
3300031334|Ga0307969_1040783All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1156Open in IMG/M
3300031335|Ga0307951_1134898All Organisms → cellular organisms → Eukaryota → Sar549Open in IMG/M
3300031387|Ga0307947_1032506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2184Open in IMG/M
3300031569|Ga0307489_10148961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1406Open in IMG/M
3300031569|Ga0307489_11058790All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta581Open in IMG/M
3300031902|Ga0302322_103456278All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta541Open in IMG/M
3300032116|Ga0315903_10592635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria853Open in IMG/M
3300032136|Ga0316201_10156211All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1988Open in IMG/M
3300032136|Ga0316201_10560459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales978Open in IMG/M
3300032231|Ga0316187_10229756All Organisms → cellular organisms → Eukaryota → Sar1428Open in IMG/M
3300032258|Ga0316191_11176230All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta554Open in IMG/M
3300032260|Ga0316192_10609630All Organisms → cellular organisms → Eukaryota → Sar739Open in IMG/M
3300032263|Ga0316195_10224965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales986Open in IMG/M
3300032272|Ga0316189_10105399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2296Open in IMG/M
3300032272|Ga0316189_10246733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1402Open in IMG/M
3300032272|Ga0316189_10780744All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta727Open in IMG/M
3300032272|Ga0316189_10797199All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens718Open in IMG/M
3300032272|Ga0316189_11518013All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300032276|Ga0316188_10246534All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta911Open in IMG/M
3300032276|Ga0316188_10299148All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta829Open in IMG/M
3300032276|Ga0316188_10520525All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta636Open in IMG/M
3300032373|Ga0316204_10318340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1201Open in IMG/M
3300033528|Ga0316588_1000030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria10493Open in IMG/M
3300034220|Ga0334921_129721All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta575Open in IMG/M
3300034820|Ga0373959_0192295All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta535Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine17.32%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow10.24%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.24%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)10.24%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.51%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.15%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water3.15%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water3.15%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent3.15%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment2.36%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.57%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.57%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.57%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.57%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.57%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.57%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.79%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.79%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.79%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer0.79%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.79%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.79%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.79%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment0.79%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.79%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.79%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.79%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.79%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.79%
Intertidal Thrombolitic MatEnvironmental → Aquatic → Marine → Intertidal Zone → Microbialites → Intertidal Thrombolitic Mat0.79%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.79%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.79%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.79%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.79%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.79%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust0.79%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.79%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.79%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.79%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000236Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS08_3EnvironmentalOpen in IMG/M
3300003554Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_04_M0_20 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003882Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0108_20120607_metagenEnvironmentalOpen in IMG/M
3300004001Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1EnvironmentalOpen in IMG/M
3300004213Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NAEnvironmentalOpen in IMG/M
3300005824Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBCEnvironmentalOpen in IMG/M
3300005825Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBBEnvironmentalOpen in IMG/M
3300005826Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBAEnvironmentalOpen in IMG/M
3300005827Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBAEnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007239Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007244Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300008020Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-22EnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300010990ELM10016_Bassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method B (2X150bp)EnvironmentalOpen in IMG/M
3300012037Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #496EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013759Intertidal thrombolitic mat microbial community from Highborne Cay, Bahamas - Thr-AEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300018605Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001754 (ERX1782444-ERR1712177)EnvironmentalOpen in IMG/M
3300018704Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782253-ERR1711956)EnvironmentalOpen in IMG/M
3300018792Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782120-ERR1711892)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019736Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_5-6_MGEnvironmentalOpen in IMG/M
3300019739Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_8-9_MGEnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020177Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020603Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150mEnvironmentalOpen in IMG/M
3300021267Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.489 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021274Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.268 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021276Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.491 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021277Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.487 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021297Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.669 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021298Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.460 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021309Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.266 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021329Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021337Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.425 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021846Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.591 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021852Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.23 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022144Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_31 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022171Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_45 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026123Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026130Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027091Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_30-Apr-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027673Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA (SPAdes)EngineeredOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027789Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028420Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028598Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028645Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_1EnvironmentalOpen in IMG/M
3300028763Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_1EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029983Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_1EnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031222Saline water microbial communities from Organic Lake, Antarctica - #780EnvironmentalOpen in IMG/M
3300031334Saline water microbial communities from Organic Lake, Antarctica - #710EnvironmentalOpen in IMG/M
3300031335Saline water microbial communities from Organic Lake, Antarctica - #374EnvironmentalOpen in IMG/M
3300031387Saline water microbial communities from Organic Lake, Antarctica - #232EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032231Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1EnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300033528Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300034220Biocrust microbial communities from Mojave Desert, California, United States - 17HMCEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TB_FS08_3DRAFT_104510013300000236GroundwaterYYAIDDILYSFQSNPNERDNLLAILYSPVLSLQNNFSINFFDIWIDEIYIHEVSKINKFLKNDSSKSEQCSYITIKLLYKSGIPFKKPDPLW*
Ga0008451J51688_13646113300003554SeawaterKYLYYAVDDISYLLKSTPIERDNLLTILYSPVLSLQNNLSINFFDIWIHEIYINEIKKVNKFLVNNSQNLECVNYVTIKLLYRTKIPVKKQESLW*
Ga0063280_106539863300003882MarineFQYPKSREILAKSFQIKYDKKLPLISKFILNSFQNKYIYYAIDDILYKLSSVPSERDNLLAILYSPIISLQNNFSVNFFDIWIRQISIEEIDQPNKFLVANDPNLKKTTYITIQFFYKTKLSVKKQNSLW*
Ga0055450_1004126233300004001Natural And Restored WetlandsLNSFKNKYIYYAIDDILYLLKSNPVEKESLLGLLYSPVLSLHNNLCINFFDIWIQEVYINETSKVNKFLTHEYQNLEQFTDVTIKFLYKTRVPVKKADSLW*
Ga0066648_1076572323300004213GroundwaterIDDILYSFKSNPREREDLLDIIYSPLISLQNNFSINFFDIWIHEIYISEVSKANKFLKNDSSNFEPLNYITIKLLYKTKVPIKKSNSLW*
Ga0074474_117773913300005824Sediment (Intertidal)PNEMMSKTFQIKYEKKLSSLAKFLLNSFRNKYIYYAVDDILYLMKSNPIERENLLTLLYSPVLWLHNNLCINFFDIWIHEIYINETSKVNKFLDNEYQNLDQFTYITIKFLYKTRVPVKKLDSLW*
Ga0074474_121192423300005824Sediment (Intertidal)ILNSFQNKYIYYAIDDILYSLKSNSIERDNLLDVLYSPILSLQNNFSVNFFDIWIRDISIDEIPKTNKFLKQNSENLEKFNYITIKLFYKTRVPVKKQDSLW*
Ga0074474_132471223300005824Sediment (Intertidal)MKYQKNLSPTAKFILNSFQNKYIYYAIDDILYSLKSNTSERNNLLAVLYSPILSLQNNFSINFFDIWIREVYIDEISKTNKFLKKDSETLEQFSYITIKLFYKTRVPVKKQESLW*
Ga0074474_154953713300005824Sediment (Intertidal)MKKKRIQDKKIIYKYKVDGLQTFQIRYDKKLSTVAKLVLNSFQKKYIYYAIDDILYSLKSNPSERDNLLAILYSPVLSLQNNFSINFFDIWIHEISINEVSKINKFLKNDSSNFEQRSYITIKLSYKTPLPLKKPDSLW*
Ga0074474_159861513300005824Sediment (Intertidal)SLSTTAKCILNSFQNKYIYYAIDDILYLLKSKPIERDNLLAVLYSPILSLQNNFSVNFFDIWIREVYIDEISKNNKFLKNDLTTLKQFNYITIKFFYKTRIPVKKQESFW*
Ga0074476_128616123300005825Sediment (Intertidal)AKFILNNFQNKYIYYAIDDILYLMKSNPIERDNLLEILYSPILSLQNNFSVNFFDIWIREVSIDEISKTNKFLTNDSKTLKQLNSITIKFFYKTRVPVKKQESFW*
Ga0074477_150107513300005826Sediment (Intertidal)NSFQKKYIYYAIDDLLYSFQFNASERNNLLAILYSPVLSLQNNFSIDFFNIWIDEIYIQEISKVNKFFKNNSSNFQPYSYITIKLLYKMPKPPKKQDFLW*
Ga0074478_191311523300005827Sediment (Intertidal)TSKTFQIKYEKRLSSIAKVIFNSFQNKYIYYAIDDVLYLLKANPVERDNLLAILYSLILSLQNNFSINFFDIWIREVSIEEISKVNKFLTLHSKSEHSQTSGQFSYITIKLLYKTRVPVKKQESLW*
Ga0074479_1041945513300005829Sediment (Intertidal)QNKYVYYAIDDILYLLKSNPIERDNVLGVLYSPILSLQNNFSVNFFEIWIRDIYIDEISKTNKFLKQDSENLEKVNYITIKLFYKTRIPIKKQESLW*
Ga0074473_1025344713300005830Sediment (Intertidal)NKYIYYAIDDILYLLKENPIERDSLLAILYSPVLSLQNNFSINFFDIWIREVYIKEMSKVNKFLTKDSPTLEQFSYITIKIFYKTKVPIKKQESLW*
Ga0074473_1072209223300005830Sediment (Intertidal)LTGTLVLYKNLIVIYDRKLSSLARFLLNSFRNKYIYYAVDDILYLMKSNPIERENLLRLLYSPVLWLHNNLCINFFDIWIHEIYINETSKVNKFLDNEYQNLDQFTYITIKFLYKTRVPVKKLDSLW*
Ga0074472_1001542813300005833Sediment (Intertidal)KLSSLARFILNSFRNNYIYYAIDDILYLLKSNPVERENLLALLSSPVLSLHNNLCINFFDIWIHEVYINETSKVNKFLNNEYQNLEQFTYITIKFLYKTRVPVKKPDSLW*
Ga0074472_1089756063300005833Sediment (Intertidal)KYIYYAIDDILYLLKSNPIERDNILAVLYSPILSLQNNFSVNFFEIWIRDIYIDEISKPNKFLKQDSDSLEKINYITIKLFYKTRIPIKKQESLW*
Ga0075513_132619113300006379AqueousFQIKYEEKLSLIAKFVLNSFQNKYIYYAIDDILYLLKSYPIERDNLLTIIYSPILLLQNNFSVDFFDIWIQEIYINKVSKVNKFIDKNFESLEQFHYITIKLLYQTRTVIKKQDSLW*
Ga0075171_142543913300007239Wastewater EffluentSIHQQS*NKLCSKNNLYPNPTELTSKTFQIKYEKPLSSVAKFLLNSFQNKYLYYAIDDLLYLLNSNVSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYINEIVNTNKFLNNNTQNFESVNYIIIKLLYRTKIPVKKQESLW*
Ga0075167_1074340113300007244Wastewater EffluentNPGELTSKTFQIKYEKQLSSVAKFLLNSFQNKYLYYAIDDIVYLLNSNPSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYINDASKTNKFLKTNSQNFETFHYITLKLLYRTKVPVKKQESLW*
Ga0105044_1027689013300007521FreshwaterKYIYYAIDDILYSFHLSQTERNNLLAVLYSPVLSLHNNFSVNFFDIWIREVYINENYKVNKFLNNSFQLSEQFSYITIKFFYKTKILMKKQESLW*
Ga0102823_119184513300007692EstuarinePLSSVAKFLLNSFQNKYLYYAIDDLLYLLNSNLSERDNLLALLYSPVLSLQNNFCINFFDIWIYDVYITEISKTNKFLNQERSNLERFSYITIKFLYKTRLPVKKVESLW*
Ga0102951_1001726163300007725WaterKYLYYAIDDILYLLKSNKVEQDELLNILYSSVLKLQNHLSINFFDIWIHEIYINEVKPKNKFLVQNSSNSNFISYITIKFLYRTKIPIKKQESLW*
Ga0102951_124349013300007725WaterIKTLKYPVESKSKLKVFQIKYEKSLSSVSKFLLNSFQKKYLYYAIDDILYILKSNPVEQNNLLEILYSPVLSLQNNLSVNFFDIWIHEIYINESKIRNKFLGTDLKNFESINYITIKLLYLPKRSIKKKESLW*
Ga0105740_102925123300007955Estuary WaterFQIKYEKKLSSLARFILNSFRNKYIYYAIDDILYLLKSNPVERESLLALLYSPVLSLHNNLCINFFDIWIHEVYINETSKVNKFLNNEYQNLEQFTYITIKFLYKTRVPVKKPDSLW*
Ga0100398_117501833300008020AquiferTAKCILNNFRNKYVYYAIDDILYSLKSRPTERDNLLAILYSPILSLQNDFSVNFFDIWVCEVYIDEISTKNKFLNTESLSLKKLNYITIKFFYKTRVAVKKQQSFW*
Ga0114351_105706863300008117Freshwater, PlanktonFLLNSFQNKYLYYAIDDIVYLLNSNPSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYINDSSKTNKFLKPNSQNFETFHYITLKLLYRTKVPVKKQESLW*
Ga0102811_119103323300009024EstuarineFQIKYEKKLSLVAKFILNSFKNKYLYYAIDDILYLLKSNPIEQESLLSILYSPVLSLQNNFCINFFDIWIYDVYITEISKTNKFLNQERSNLERFSYITIKFLYKTRLPVKKVESLW*
Ga0102829_108788313300009026EstuarineIMSKTFQIKYEKKLSLVAKFILNSFKNKYLYYAIDDILYLLKSNPIEQESLLSILYSPVLSLQNNFCINFFDIWIYDVYITEISKTNKFLNQERSNLERFSYITIKFLYKTRLPVKKVESLW*
Ga0102829_131939113300009026EstuarineLEEVTLKTFQIKYNKKLSSVAKLILNSFQNKYIYYAMDDILYSFRSNPMERDNLLAILYSPVLSLQNNLSTNFFDIWIHEIHIHEVSKVNRFLKHDFKNVKQLNYITIKLFYKTGIPVKKRESLW*
Ga0102957_103440743300009027Pond WaterYYAIDDILYLLKSNKVEQDELLNILYSSVLKLQNHLSINFFDIWIHEIYINEVKPKNKFLVQNSSNSNFISYITIKFLYRTKIPIKKQESLW*
Ga0102815_1064016813300009080EstuarineFILNSFRNKYIYYAMDDILYLFQSNPVERESLLALLSSPVLSLHNNLCINFFDIWIQEVYINETSKVNKFLTNEYQNLEQFTYITIKFLYKTRVPVKKPDSLW*
Ga0102812_1047888713300009086EstuarineKLLPYIKKPLYEIEGIEEIPPKIFTFQIKYEKKLSSIAKFILNSFQNKYIYYAIDDILYSFKSNPSERENLLAILYSPVISLQNNFSINFFDIWIHEIYINEVSKVNKFLNNDSSNFEQFNYITIKLLYKTRIPIKKPDSLW*
Ga0115028_1170455113300009179WetlandKPNEITSKTFQIKYHDKLSLTAKFILNSFQNKYIYYAIDDILYLFELNKTERNNLLAILYSPVLSLQNNFFVNFFDIWIREVYIDEVSKVNKFLNQDSQTSEQFSYIIIKFFYKTRVPVKKQESLW*
Ga0115008_1052876413300009436MarineKIFTFQIKYEKKLSSIAKIILNSFHNKYIYYAIDDILYLLKSTPIERDNLLSIIYSPIISLQNNFSINFFDIWIHEIYINEVSKVNKFIDNNSQNLEKFNYITIKLFYKTGVPTKKQHTLW*
Ga0114942_117806223300009527GroundwaterPKPNEITSKTFQIEYHKTLSSTGKLILNSFQNKYIYYAIDDILYSFKTDSAERENLLAILYSPVLSLQNNFSVNFFDIWIRQVSIEEISKVNKFLTTSQTSELFSYITIKLLYKTRVPVKKQESLW*
Ga0115103_178429313300009599MarineALDDILYLFKTNPIERDNLLTLLYSPVLSLQNNFSINFFDIWIHEVFINEIKKDNKFLIPNSKNTESIQYITIKFLYRTKSPLKKQESLW*
Ga0115100_1007788213300009608MarineNSFQNKYIYYGMDDILYQFGLDSNEYETLLAILYSPIISLQNNYCVNFFDIWVNEIYIEEDSKPNKFLSNEFQSLSQFTYITVKFFYKTKIPTKKQESLW*
Ga0136852_1165704723300010412Mangrove SedimentAMDDILYGLKSNPIERDNLLAILYSPILSLQNNFSVTFFDIWIREVYIDEIAKTNKFLSKNLELSDQFNLITIKLFYKTKIPVKKQESLW*
Ga0139325_10341313300010990SedimentCKTFQIKYDGKLSLLAKFILNSFQNKYIYYGIDDILYQFGFGSNEYETLLAILYSPVISLQNNYSVNFFDIWVSEIYIDEGSKPNKFLTNESQTFSQFTYITVTFFYKTKVPTKKQESLW
Ga0136559_107106213300012037Saline LakePFFYPNSTELTSKTFQIKYEKQLSSVAKFLLNSFQNKYLYYAIDDILYLLNSNANERDNLLALLYSPVLSLQNNLSVNFFDIWIQEVYINEVSKTNKFLKTNSNNFESFNYITIKLLYRTKIPVKKQESLW*
Ga0138259_175086513300012416Polar MarineLILNSFQNKYIYYAMDDILYLLKLDTIERDNLLAILYSPILSLQNNFSVNFFDIWIREVYIDETLKVNKFLHNDTQSLKHFSSITITFFYKTRVPAKKQDSLW*
Ga0129337_131297013300012968AqueousKTFQIKYEKNLSSVAKFLLNSFQNKYLYYAIDDILYLLKSNPSERDNLLALLYSPVLSLQNNFSINFFDIWIQEIYITEVSKTNKFLQMTDSSFESFHSITIKLLYRTKIPMKQQESLW*
Ga0119972_108882113300013759Intertidal Thrombolitic MatITKKQTKKKRKEGRSIKYPSIEKRISKTFQIRYDKTLSLTAKFILNSFQNKYFYYAIDDILYLLKFDPIERDSLLTVLYSPVISLQNNFSINFFDIWIEQIYINEIEKVNKFLTNDSQNFEHFSYITLTLIYKTSEPVQKLEALW*
(restricted) Ga0172376_1028280913300014720FreshwaterYLYYAIDDILYLLNSNPSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYINDVSKTNKFLKTNLQSVETFHYITVKLLYRIKVPVKKQESLW*
Ga0193339_101217213300018605MarineTTKLILNSFQNKYIYYAIDDILYFLKSSPIEKENLLSIIYSPIISLQNNFSINFFDIWIEGIYINEVSKVNKFIANNSQNLEQFSYITIKLVFRPGVPIKKREILW
Ga0192954_101517523300018704MarineSVVAKFILNSFHNKYLYYAIDDILYLLKSHSVEQENLLNILYSPVLALHNNFSINFFDIWIHEIYITEAKTKNKFLVQKTTSLKPITYITVKLLYRTKVLIKKQESLW
Ga0192954_101519323300018704MarineSVVAKFILNSFHNKYLYYAIDDILYLLKSHSVEQENLLNILYSSVLALQNNFSINFFDIWIHEIYITEAKVKNKFLVQKTTSFKPITFITIKLLYRTKVLIKKQESLW
Ga0192956_115060713300018792MarineYEKKLSSVAKLVLNSFKNKYLYYAIDDISYSFESNPKERDNLLGILKSLVLSLQNNFSINFFDIWIYEIYINETSKVNKFLNNDLSNLEQGTCITIKLLYKTPISPKKLDSLW
Ga0193552_1002058333300018934MarineSFQNKYIYYAIDDILYLFQFNPTERNNLLAILYAPVLSLHNSSSINFFDIWINQIYINEGSKVNKFLKNDYYNLKTYSYITIKFLYKKGVPVKKVEPLW
Ga0193516_1004755813300019031MarineLSSIAKLLLNSFQNKYLYYAIDDILELLKSNPIERDNLLAILYSPVLSLQNNLSINFFDIWIHEIYIDQTSKNNKFLTTQIQNSECFYYITIKLLYRKRVPIKKQESLW
Ga0192886_1030988723300019037MarineILNSFQNKYIYYAIDDILYSLKLTTNEQDSLLSVLYSPIISLQNNFSVNFLDIWIQEIYIDEIPKTNRFINNELKFSKEFSLIIIKFFYKTKVPAKQQESLW
Ga0193082_1006342813300019049MarineDDILELLKSNPIERDNLLSILYSPVLSLQNNLSINFFDIWIHEIYIERTSKKNKFLNTEIQNSECFYYITIKLLYRKKVPIKKQESLW
Ga0193082_1037537413300019049MarineNSFQNKYIYYAIDDILYFLKSSPIEQEDILSIIYSPVLSLQNNFSINFFDIWIEEIYINEVSKVNKFITNNSQNLEQFTYITIKLFFRPGVPIKKRDILW
Ga0193356_1024408623300019053MarineFHNKYLYYAIDDILYLLKSHSVEQANLLNILYSPVLALQNNFSINFFDIWIHEIYITEAKTKNKFLVQKTTSLKPITFITIKLLYRTKVLIKKQESLW
Ga0193436_105734613300019129MarineQIKYERNLSPIAKLLLNSFQNKYLYYAIDDILYSLKSNSIERDNILAVLYSPVISLQNNISVNFFDIWIQEIYINEVSKANKFLTNKSSNFESFSYITIKFLYKVTTPNKKQESLW
Ga0194019_103291113300019736SedimentKYIYYAIDDILYLLNSNPIERDNLLFILYSPMLLLQNNFYINFFDIWIQEVYIKETSKPNKFLSQDCKNLKIVNCIIIKLLYKKSSPIQKVDSLW
Ga0194012_102615423300019739SedimentPDPDEIDEEKIEKFLEDVKNRIVKTFQIKYERKLSSIAKLLLNSFQNKYLYYAIDDVLYLLKSNPIERDNLLGILYSPVLSLQNNLSINFFEIWIDEIYISEIPKVNKFLTNNGQNFEPFCYITIKLLYIPTKPIKQKESLW
Ga0211733_1046456923300020160FreshwaterAIDDIVYLLNSNPSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYINDSSKTNKFLKPNSQNFETFHYITLKLLYRTKVPVKKQESLW
Ga0181596_1021950223300020177Salt MarshYPNQNEITSKTFQIKYEKNLSLIAKFVLSSFQNKYLYYAIDDILYFFKANPIERDNLLSLIYSPVLSLQNNFSINFFDIWIHEIYLNEIKKNNKFLIPNSKNTESIQYITIKFLYRTKSPVKKQESLW
Ga0194115_1009615113300020183Freshwater LakeAIDDILYLLNSNPSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYINDVNKTNKFLKTNSQNFETFHYITVKLLYRTKVPVKKQESLW
Ga0194124_1007397813300020196Freshwater LakeFPGELTSKTFQIKYEKQFSSVAKFLLNSFQNKYLYYAIDDILYLLNSNPSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYINDVNKTNKFLKTNSQNFETFHYITVKLLYRTKVPVKKQESLW
Ga0194126_1018885533300020603Freshwater LakeKYEKQFSSVAKFLLNSFQNKYLYYAIDDILYLLNSNPSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYINDVNKTNKFLKTNSQNFETFHYITVKLLYRTKVPVKKQESLW
Ga0210353_14311413300021267EstuarineLILNSFQNKYIYYAMDDILYSFRSNPMERDNLLAILYSPVLSLQNNLSTNFFDIWIHEIHIHEVSKVNRFLKHDFKNVKQLNYITIKLFYKTRVPSKKRDSLW
Ga0210327_11455413300021274EstuarineIDDILYLLKSNPVERESILGLLYSPVLSLHNNLCINFFDIWIQEVYINETSKGNKFLTNEYQNLEQFTYITIKFLYKTRVPVKKADSLW
Ga0210354_111806613300021276EstuarineKYIYYAMDDILYSFRSNPMERDNLLAILYSPVLSLQNNLSTNFFDIWIHEIHIHEVSKVNRFLKHDFKNVKQLNYITIKLFYKTRVPSKKRDSLW
Ga0210352_14903223300021277EstuarineILNNFQNKYIYYAIDDILYLLKSNPVERESILGLLYSPVLSLHNNLCINFFDIWIQEVYINETSKGNKFLTNEYQNLEQFTYITIKFLYKTRVPVKKADSLW
Ga0210369_104907423300021297EstuarineMKYQTSLSPTAKCLLNNFQNKYIYYAIDDILYLLKAKPVERDNLLAVLYSPILSLQNNFSVNFFDIWIRDVYIDEISKTNRFLKNDSTTFKEFNYITIKFFYKTRVPVKKQESLW
Ga0210349_108931423300021298EstuarineLSTTAKCLLNNFQNKYIYYAIDDILYLLKTKPVERDNLLAVLYSPILSLQNNFSVNFFDIWIRDVYIDEISKTNRFLKNDSTTFKEFNYITIKFFYKTRVPVKKQESLW
Ga0210349_120913823300021298EstuarineILYLLNSNSSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYINEVSKTNRFLNTNKNFESFNYITIKLLYRTKIPVKKQESLW
Ga0210296_100465013300021305EstuarineKTFQIKYEKKLSLVARFILTSFRNKYLYYAIDDILYLLKANPIERENLLSILYSPVLSLQNNFCINFFDIWIYDVYITEISKTNKFLNQERSNLERFSYITIKFLYKTRLPVKKVESLW
Ga0210326_110094933300021309EstuarineEVTLKTFQIKYNKKLSTIAKLILNSFQNKYIYYAMDDILYSFRSNPMERDNLLAILYSPVLSLQNNLSINFFDIWIHEIHIHEVSKANRFLKHDFKNVKQLNYITIKLFYKTRVPSKKRDSLW
Ga0210362_131735613300021329EstuarineMTSQTFQIKYEKKLSSTAKAIFNSFHNKYIYYAIDDILYSLKGNLIERDSLLAILYSTILSLQNNFSVNFFDIWIREVYIQEISKMNPFLNQDSQTLTQFSYITIKLFYKTRVPVKKQESLW
Ga0210341_106505113300021337EstuarineIYYAMDDILYSFRSNPMERDNLLAILYSPVLSLQNNFSINFFDIWIDEIYINEISKVNKFLNNDSSNLEQCSYIIIKLLYKTRMPVKKPESLW
Ga0213859_1046100613300021364SeawaterYAIDDILYFFKANPIERDNLLSLIYSPVLSLQNNFSINFFDIWIHEIYIDEVIKGNKFLNKNSRKFEPFNYITIKLLYRTKVPIKKQESLW
Ga0194117_1021871533300021424Freshwater LakeIKYEKQFSSVAKFLLNSFQNKYLYYAIDDILYLLNSNPSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYINDVNKTNKFLKTNSQNFETFHYITVKLLYRTKVPVKKQESLW
Ga0210359_16027013300021846EstuarineNKYIYYAIDDILYSLKSKPIERDNLLAVLYSPILSLQNNFSVNFFDIWIREVYIDEISKNNKFLKNDSTTLKQFNYITIKFFYKTRVPVKKQASLW
Ga0210317_117208213300021852EstuarineYIYYAIDDILYLLKLNQIERDNLLAILYSPVLSLHNNFSVNFFDIWIREVSIDEISKVNKFLNKDSQPSEQFSYITIKLFYKTKVPVKKQESLW
Ga0222714_1067885023300021961Estuarine WaterQIKYEKKLSSIAKLLLNNFQTKYFYYAIDDILYLLKSNPIERDNILEILYSPVLSLQNNLSINFFDIWIHEIYISETSKINKFLAKDCQNLESFSYITIKLLYTTKIPTKKQESLW
Ga0213855_103524313300022144WatershedsLNSFQNKYIYYAIDDILETFQNSPVERDQLLGLIYSPILSLQNHFSINFFDIWIRQVYIEEIVKPNKFLTKESEGFIQFTSITIEFIYNVKAPVKKPEALW
Ga0213857_103981913300022171WatershedsKFLLNSFQNKYLYYAIDDLLYLLNSNLSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYIHQSLKTNKFLKTNSPTFESSNYIIIKLLYRTKIPVKKQESLW
Ga0209652_114702813300025684MarineDRKLSSMAKFILNSFQNKYIYYAIDDILYLLKANSIERDNLLRILYSPVISLQNNFSVNFFDIWIQELYIQDVSKVNKFIANDYNKMEQFSYITIKLLYKTRVPIKKQDSLW
Ga0209955_106463023300026123WaterQLSLTSKLILNSFQNKYIYYAIDDILYTLKGSPFERDNLLAVLYSPILSLQNNFSVNFFDIWIRQVYVEEVSKSNKFLKSEFKATNQSTNITIQFFYKTRIPSKKQESLW
Ga0209961_100762673300026130WaterKYLYYAIDDILYLLKSNKVEQDELLNILYSSVLKLQNHLSINFFDIWIHEIYINEVKPKNKFLVQNSSNSNFISYITIKFLYRTKIPIKKQESLW
Ga0209873_102780713300027091SandLQYPKHSEITSKIFQIEYHEHLSLTAKFILNSFHNKYIYYAIDDILYSLRSNPSERDNLLAVLYSPILSLQNDFLVNFFDIWIRDISLNEISKSNKFLKQEAENLEKVNLITIKLFYKTRVPIKKQESLW
Ga0208437_105141533300027525EstuarineFQIKYERNLSPIAKFLLNSFQNKYLYYAMDDILYSLKSNPIERDNILAILYSPVLSLQNNLSINFFDIWVHEIYISKVSKVNKFLTNNCQNFEPFSYITIKLLYKVTIPSKKQESLW
Ga0209278_104831733300027673Wastewater EffluentNEITSKTFQIQYQNKLSVTSRLILNSFQNKYIYYAIDDILYSLKCSSFERDNLLAVLYSPILSLQNNFSVNFFDIWIRQVYIEEVSKPNKFLKANFETSDQITNITIQFFYKTRIPVKKQESLW
Ga0208671_1002618523300027757EstuarineMNQILYEKICRCNSIRSSTNLSEGKLLPYIKKPLYEIEGIEEIPPKIFTFQIKYEKKLSSIAKFILNSFQNKYIYYAIDDILYLLSSNPIERDELLRILYSSMLSLHNEFTINFFDIWIDSVYLNETFQTNRFCTYQTKNLNQIQTTTIILKLRYFKRSPIKKSDPLW
Ga0209174_1028918713300027789Wastewater EffluentEYNEKLSLAAKFILNSFQNKYIYYAIDDILYSFRSNPIERDNLLAVLYSPILSLQNNFLVNFFDIWIRDIYIDEISKTNKFLKKDSENLYKVTYITIKLFYKTRVPIKKQESLW
Ga0209712_1082081313300027849MarineSIAKFLLNSFQNKYLYYAIDDILYLLKSNPIERDNLLTILYSPVLSLQNNLSINFFDIWIHEIYINEVSKVNKFLTNKCQNFEPFSYITIKLLYRTKIPIKKQESLW
Ga0210366_1036983013300028420EstuarineNKYIYYAIDDILYLLKSKPIERDNLLAILYSPILSLQNNFSVDFFEIWIREVFIDEISKTNKFLKNDSKTLKQSNYITIKFFYKIPVKKKESLWEF
Ga0265306_1057880123300028598SedimentNEITSQTFQIKYDKKLSSIAKAILNSFQNKYIYYAIDDILYLLKGNPLERENILAILYSPVLSLQNNFSVNFFDIWIRDVYIEEISKVNKFLTKDSQTLTQFSCITIKLFYKTRVPVKKQESLW
Ga0265303_1053824123300028600SedimentKLSLTSKFILNSFQNKYIYYAIDDILYTLKSSPIERDNLLAILYSPILSLQNNFSVNFFDIWIRQVYIEEISKTNKFLSNDSQTLDQFSYITIQFFYKTKVPVKKQESLW
Ga0265303_1154034013300028600SedimentQYPNSNEITSQTFQIKYDKKLSSIAKAILNSFQNKYIYYAIDDILDLLKGNPIERENLLAILYSPVLSLQNNFSVNFFDIWIREVYIEEISKVNKFLTKDSQTLTQFSCITIKLFYKTRVPVKKQESLW
Ga0302158_102415113300028645FenIYYAIDDILYLLKSNPVERDNLLEILYSQVLSLQNNLSVNFFDIWIHEIYINEISKVNKFINNDSQNFEQFTFLTIKLLYKTRIPIKKPESLW
Ga0302204_107833223300028763FenIDDILYLLKSNPVERDNLLAILYSQVLSLQNNLSVNFFDIWIHEIYINEISKVNKFLTNDSQNFEQFTYITIKLLYKTRIPIKKPESLW
Ga0311347_1056447923300029923FenLILNSFRNKYIYYAIDDILYLLKSNPVERDNLLAILYSQVLSLQNNLSVNFFDIWIHEIYINEISKVNKFLTNDSQNFEQFTYITIKLLYKTRIPIKKPESLW
Ga0302284_117224623300029983FenLNSFRNKYIYYAIDDILYLLKSNPVERDNLLAILYSQVLSLQNNLSVNFFDIWIHEIYINEISKVNKFLTNDSQNFEQFTYITIKLLYKTRIPIKKPESLW
Ga0311337_1102954213300030000FenAIDDILYLLKSNPIERDNLLSILYSQVLSLQNNLSVNFFDIWIYEIYINEISKVNKFINNDSQNFEQFTYITIKLLYKTRIPIKKPESLW
Ga0311337_1170307713300030000FenYAIDDILYSFKSNPIERDNILAILYSPILSLQNNFLVNFFDIWIRDIYIDEISKTNKFLKQDSENSDQVTYITIKLFYKTRVPIKKQESLW
Ga0307972_111412933300031222Saline WaterLSSTAKLILNSFQNKYIYYAIDDILYLLKLDSVERDNLLAILYSPILSLQNNFSVNFFDIWIREVYIDETSKVNKFLHNDNKDFQHFSYITITFFYKTRVPAKKQESLW
Ga0307969_104078313300031334Saline WaterYPKSNEITSKTFQIKYEKNLSSTAKLILNSFQNKYIYYAIDDILYLLKLDSVERDNLLAILYSPILSLQNNFSVNFFDIWIREVYIDETSKVNKFLHNDNKDFQHFSYITITFFYKTRVPAKKQESLW
Ga0307951_113489813300031335Saline WaterSKTFQIKYDKRLSSVAKFLLNSFQNKYLYYAIDDILYLLNSNSSERDNLLALLYSPVLSLQNNLSVNFFDIWIQEVYINEVAKTNKFLNTNYHNFESFNHITIKLLYRTKVPVKKQESLW
Ga0307947_103250613300031387Saline WaterKSNLVEQENLLNILYSSVLALHNNLSINFFDIWIHEIYINETKIRNKFLVQNTANSKAISYITIKLLYRTKVPTKKQESLW
Ga0307489_1014896133300031569Sackhole BrineRSKTFQIKYEKRLSSTAKFILNSFQNKYIYYAIDDILYSLKSNPLERDNILAILYSPILSLQNNFSVNFFDIWIREIYIDEISKVNKFLTTESQTYEQFSYITLKLFYKTRVPVKKQESL
Ga0307489_1105879013300031569Sackhole BrinePTAKFILSSFQNKYIYYAIDDILYSLKSNPIERDNLLAVLYSPILSLQNNFSVNFFDIWIRDVYIDEISKPNKFLKKDSETLEKFNSITIKLFYKTRVPVKKQESLW
Ga0302322_10345627813300031902FenLILNSFRNKYIYYAIDDILYLLKSNPVERDNLLEILYSQVLSLQNNLSVNFFDIWIHEIYINEISKVNKFINNDSQNFEQFTFITIKLLYKTRIPIKKPESLW
Ga0315903_1059263533300032116FreshwaterFQNKYLYYAIDDLLYLLNSNISERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYIHQTMKTNKFLKTNTPTFESSNYIIIKLLYRTKIPVKKQESLW
Ga0316201_1015621113300032136Worm BurrowISKTFQIKYDKKLSTTSKFILNSFQNKYIYYAIDDILYLFELNQTERNNLLAILYSPVLSLQNNFFVNFFDIWIREIYIDEVSKVNKFLNQDSQTSEQFSYIIIKFFYKTRVPVKKQESL
Ga0316201_1056045933300032136Worm BurrowYIYYAIDDILYSFKSNPNERDNLLAILYSPVLSLHNNFSINFSDIWIHEISINEVSKINKFLKNESSNFEQLNYITIKLLYKFKSPSKKPDSLW
Ga0316187_1022975643300032231Worm BurrowLNSFKNKYIYYAIDDILYLLKSNPVEKENLLGLLYSPVLSLHNNLCINFFDIWIQEVYITETTKVNKFLTNEYQNLEQFTYITIKFLYKTR
Ga0316191_1117623013300032258Worm BurrowKPSEIMSKTFQIKYHETLSPTARFILNSFQNKYIYYAIDDILYSLKSNSIERDNLLAVLYSPILSLQNNFSVNFFDIWIRDISIDEISTTNKFLKRNSENLEKFNYITIKLFYKTRVPVKKQDSLW
Ga0316192_1060963023300032260Worm BurrowFQLKYDKKLSSTAKLILNNFQNKYIYYAMDDILYLLNLDVVERDNLLAILYSPVLSLQNNFSVNFFDIWIREIYIDETSKPNKFLQNNSQNIEHFNYITIKLFYKTRVPVKKQESLW
Ga0316195_1022496513300032263SedimentLNSFQNKYIYYAIDDILYLFELNKNERENLLSILYSPILSLQNNYSVNFFDIWIKEIYIDEISKSNKFLSTDSQTSKQFSYITIRLFYKTKVPLKKQESLW
Ga0316189_1010539953300032272Worm BurrowLILNSFQNKYIYYAMDDILYSFRSNPMERDNLLAILYSPVLSLQNNLSINFFDIWIHEIHIHEVSKVNRFLKHDFKNVKQLNYITIKLFYKTRVPSKKRDSLW
Ga0316189_1024673333300032272Worm BurrowQNKYIYYAMDDILYSFELNQTERNNLLAILYSPVLSLQNNFFVNFFDIWIREIYIEEVSKVNKFLPKDSSTSPQFSYIIIKFFYKTRVPVKKQESLW
Ga0316189_1078074423300032272Worm BurrowIIYKTFQIKYDKKLSITSKFILNSFQNKYIYYAIDDILYLFELNQTERNNLLAILYSPVLSLQNNFFVNFFDIWIREIYIDEVSKVNKFLNQDSQTSEQFSYIVIKFFYKTRVPVKKQESLW
Ga0316189_1079719913300032272Worm BurrowFQNKYIYYAMDDILYLLNLDVVERDNLLAILYSPVLSLQNNFSVNFFDIWIREIYIDETSKPNKFLQNNSQNIEHFNYITIKLFYKTRVPVKKQESLW
Ga0316189_1151801313300032272Worm BurrowKKYIYYAIDDILYSFQSNPTERDNLLAILYSPVLSLQNNFSIDFFNIWIDEIYIQEISKVNKFFKNNSSNFQQYNYITIKLLYKMPRPPKKQDFLW
Ga0316188_1024653423300032276Worm BurrowAKFILNSFQNKYIYYAIDDILYLLKSNPVERESLLGLLYSPVLSLHNNLCINFFDIWIQEVYLNERSKVNKFLSSQSQNLEPFTEITIKFLYKTRVPVKKADSLW
Ga0316188_1029914823300032276Worm BurrowLVLNSFHNKYIYYAIDDILYSFKSNPYERDNLLAILYSPILSLQNNFSINFFDIWIHEIYINEISKVNKFLNNDSLNFEQFSYITIKLLYKTRVPIKKQDSLW
Ga0316188_1052052523300032276Worm BurrowKFILNSFQNKYIYYAIDDILYSFKSNPKERENLLAILYSPILSLQNNFSINFFDIWIDELYINQISRVNKFLKSESSNFKQINYITIKLVYKKRIPVKKPDSLW
Ga0316204_1031834013300032373Microbial MatKYEKELSSIAKFVLNSFQNKYIYYAIDDILYLLKSNPIERDNLLAIIYSPVLSLQNNFSINFFDIWIHEIYINEVSKINKFITNDSQNFEPFNYITIKLLYKTRVPIKKQDSLW
Ga0316588_100003063300033528RhizosphereMITKKPKLNKKGRGRPVRYPESGKVRVFQIKYKKPLSSLAKFVLNSFDNKYIYHAIDDILYSFQSNPIERDNLLAILYSPIISLQNNFSIRFFDIWIDEIYINEISKVNKFLTKDSSNFEQFSYITIKLLYQTRIPTKKQDSLW
Ga0334921_129721_274_5733300034220Hypolithic BiocrustSFQNKYIYYAIDDILYMFSLNSLERNNLLAILYSPVLSLHNNFSVNFFDIWISEIYIEEVSKSNKFIDKNSKTSDQFTYITIKFFYRTRIPIKKQQFLW
Ga0373959_0192295_192_5333300034820Rhizosphere SoilYEKKLSTIEKLILNSFQNKYIYYAIDDILYSLNINQNEKKSLLSILYSPVLSLHNNFSVNFFDIWIRDVSIDENLKVNKFLSDNFELSEQFSSITITFFYKTRIPTKKQEALW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.