| Basic Information | |
|---|---|
| Family ID | F061214 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VISARCRLVNGFAKLTNISLALKETPINGGLTYEGPKVAEYPGR |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 7.58 % |
| % of genes near scaffold ends (potentially truncated) | 56.82 % |
| % of genes from short scaffolds (< 2000 bps) | 87.12 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (86.364 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (9.848 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.970 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.303 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.17% β-sheet: 0.00% Coil/Unstructured: 70.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF05933 | Fun_ATP-synt_8 | 0.76 |
| PF00510 | COX3 | 0.76 |
| PF00137 | ATP-synt_C | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 0.76 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.36 % |
| Unclassified | root | N/A | 13.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000902|JGI12144J12865_100361 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1394 | Open in IMG/M |
| 3300001085|JGI12187J13240_100369 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 943 | Open in IMG/M |
| 3300001108|JGI12647J13326_102374 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 686 | Open in IMG/M |
| 3300001134|JGI12688J13320_100518 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 664 | Open in IMG/M |
| 3300001176|JGI12655J13551_101178 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 664 | Open in IMG/M |
| 3300001179|JGI12660J13575_100008 | Not Available | 4186 | Open in IMG/M |
| 3300001661|JGI12053J15887_10168706 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1135 | Open in IMG/M |
| 3300001686|C688J18823_10044598 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 3062 | Open in IMG/M |
| 3300001738|JGI24657J20077_1027853 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 671 | Open in IMG/M |
| 3300002121|C687J26615_10001974 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 4162 | Open in IMG/M |
| 3300002875|Ga0006800J43185_101782 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1449 | Open in IMG/M |
| 3300003220|JGI26342J46808_1000812 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 2372 | Open in IMG/M |
| 3300003674|Ga0006876_102592 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1781 | Open in IMG/M |
| 3300004130|Ga0058895_1117271 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 825 | Open in IMG/M |
| 3300004132|Ga0058902_1004823 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1020 | Open in IMG/M |
| 3300004134|Ga0058906_1348190 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 525 | Open in IMG/M |
| 3300004135|Ga0058884_1015579 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 1770 | Open in IMG/M |
| 3300004136|Ga0058889_1031742 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1735 | Open in IMG/M |
| 3300004136|Ga0058889_1420871 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1137 | Open in IMG/M |
| 3300004213|Ga0066648_10168724 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1229 | Open in IMG/M |
| 3300004294|Ga0068945_1001799 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 1527 | Open in IMG/M |
| 3300004473|Ga0068919_1009749 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1869 | Open in IMG/M |
| 3300004474|Ga0068968_1508586 | Not Available | 522 | Open in IMG/M |
| 3300004487|Ga0068950_181527 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 949 | Open in IMG/M |
| 3300004526|Ga0066566_103901 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 3421 | Open in IMG/M |
| 3300004561|Ga0068921_1031978 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 672 | Open in IMG/M |
| 3300004561|Ga0068921_1210730 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 591 | Open in IMG/M |
| 3300004799|Ga0058863_10115466 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1969 | Open in IMG/M |
| 3300004801|Ga0058860_12184815 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 616 | Open in IMG/M |
| 3300004970|Ga0072320_1047376 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 650 | Open in IMG/M |
| 3300005171|Ga0066677_10322900 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 884 | Open in IMG/M |
| 3300005335|Ga0070666_10234194 | Not Available | 1297 | Open in IMG/M |
| 3300005341|Ga0070691_10940621 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia coronata → Puccinia coronata var. avenae → Puccinia coronata f. sp. avenae | 536 | Open in IMG/M |
| 3300005434|Ga0070709_10103274 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1902 | Open in IMG/M |
| 3300005436|Ga0070713_100409677 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1267 | Open in IMG/M |
| 3300005457|Ga0070662_100295192 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1315 | Open in IMG/M |
| 3300005536|Ga0070697_101494510 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 604 | Open in IMG/M |
| 3300005537|Ga0070730_10086834 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 2183 | Open in IMG/M |
| 3300005557|Ga0066704_10092678 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes | 1973 | Open in IMG/M |
| 3300005560|Ga0066670_10462600 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 781 | Open in IMG/M |
| 3300005562|Ga0058697_10276076 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 793 | Open in IMG/M |
| 3300005575|Ga0066702_10212448 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1174 | Open in IMG/M |
| 3300005617|Ga0068859_100197025 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 2099 | Open in IMG/M |
| 3300005661|Ga0058698_10767318 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 604 | Open in IMG/M |
| 3300005843|Ga0068860_102139852 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 581 | Open in IMG/M |
| 3300005950|Ga0066787_10110850 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 592 | Open in IMG/M |
| 3300005983|Ga0081540_1103603 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1219 | Open in IMG/M |
| 3300005993|Ga0080027_10020223 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2368 | Open in IMG/M |
| 3300006102|Ga0075015_100833611 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 555 | Open in IMG/M |
| 3300006173|Ga0070716_100084649 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 1902 | Open in IMG/M |
| 3300006176|Ga0070765_100267479 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes | 1572 | Open in IMG/M |
| 3300006176|Ga0070765_100348653 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1376 | Open in IMG/M |
| 3300006642|Ga0075521_10547375 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 568 | Open in IMG/M |
| 3300006711|Ga0031673_1045674 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 687 | Open in IMG/M |
| 3300006791|Ga0066653_10122948 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1221 | Open in IMG/M |
| 3300006881|Ga0068865_100588904 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 939 | Open in IMG/M |
| 3300009174|Ga0105241_10116849 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 2143 | Open in IMG/M |
| 3300010080|Ga0127448_162280 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 924 | Open in IMG/M |
| 3300010113|Ga0127444_1107993 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 906 | Open in IMG/M |
| 3300010123|Ga0127479_1080159 | Not Available | 525 | Open in IMG/M |
| 3300010192|Ga0127506_1013043 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1318 | Open in IMG/M |
| 3300011083|Ga0138560_1016146 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 1204 | Open in IMG/M |
| 3300012404|Ga0134024_1361893 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1185 | Open in IMG/M |
| 3300012778|Ga0138269_1157447 | Not Available | 556 | Open in IMG/M |
| 3300012898|Ga0157293_10137366 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 676 | Open in IMG/M |
| 3300012930|Ga0137407_10478016 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1162 | Open in IMG/M |
| 3300013041|Ga0154017_17441 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 663 | Open in IMG/M |
| 3300013865|Ga0181471_102438 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2934 | Open in IMG/M |
| 3300017944|Ga0187786_10163220 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 816 | Open in IMG/M |
| 3300018624|Ga0193577_112552 | Not Available | 501 | Open in IMG/M |
| 3300018760|Ga0103504_10000191 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 978 | Open in IMG/M |
| 3300020021|Ga0193726_1194451 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 857 | Open in IMG/M |
| 3300020081|Ga0206354_11673928 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 2032 | Open in IMG/M |
| 3300020582|Ga0210395_10380235 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1062 | Open in IMG/M |
| 3300021415|Ga0193694_1052157 | Not Available | 562 | Open in IMG/M |
| 3300021857|Ga0213849_1074751 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 910 | Open in IMG/M |
| 3300022509|Ga0242649_1010613 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 976 | Open in IMG/M |
| 3300022716|Ga0242673_1068226 | Not Available | 633 | Open in IMG/M |
| 3300022729|Ga0228599_103946 | Not Available | 797 | Open in IMG/M |
| 3300022750|Ga0247812_10147524 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 944 | Open in IMG/M |
| 3300022932|Ga0247807_10027960 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 2355 | Open in IMG/M |
| 3300023063|Ga0233335_1045563 | Not Available | 843 | Open in IMG/M |
| 3300023267|Ga0247771_1061858 | Not Available | 1130 | Open in IMG/M |
| 3300023275|Ga0247776_10094395 | Not Available | 1160 | Open in IMG/M |
| 3300023664|Ga0247527_112072 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 594 | Open in IMG/M |
| 3300023675|Ga0247533_102637 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia coronata → Puccinia coronata var. avenae → Puccinia coronata f. sp. avenae | 695 | Open in IMG/M |
| 3300023677|Ga0247543_100546 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1104 | Open in IMG/M |
| 3300024486|Ga0255059_10373069 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 666 | Open in IMG/M |
| 3300025321|Ga0207656_10004989 | All Organisms → cellular organisms → Eukaryota | 4662 | Open in IMG/M |
| 3300026281|Ga0209863_10017670 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2208 | Open in IMG/M |
| 3300026496|Ga0257157_1015527 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1224 | Open in IMG/M |
| 3300028674|Ga0302161_10000617 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes | 9564 | Open in IMG/M |
| 3300028747|Ga0302219_10053284 | All Organisms → cellular organisms → Eukaryota | 1508 | Open in IMG/M |
| 3300028873|Ga0302197_10474217 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 547 | Open in IMG/M |
| 3300028874|Ga0302155_10009210 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales | 5465 | Open in IMG/M |
| 3300029907|Ga0311329_10285155 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1208 | Open in IMG/M |
| 3300029915|Ga0311358_10313851 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1321 | Open in IMG/M |
| 3300029983|Ga0302284_1032829 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1882 | Open in IMG/M |
| 3300030004|Ga0302186_10128364 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 914 | Open in IMG/M |
| 3300030013|Ga0302178_10304850 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 732 | Open in IMG/M |
| 3300030508|Ga0302185_10115563 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 953 | Open in IMG/M |
| 3300030561|Ga0257200_1017854 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 783 | Open in IMG/M |
| 3300030579|Ga0247633_10090584 | Not Available | 717 | Open in IMG/M |
| 3300030580|Ga0311355_10608006 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1030 | Open in IMG/M |
| 3300030583|Ga0210262_1081777 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 734 | Open in IMG/M |
| 3300030612|Ga0257196_1200398 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 699 | Open in IMG/M |
| 3300030618|Ga0311354_10739008 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 936 | Open in IMG/M |
| 3300030618|Ga0311354_11774471 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 537 | Open in IMG/M |
| 3300030688|Ga0311345_10558233 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 964 | Open in IMG/M |
| 3300030746|Ga0302312_10107918 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1134 | Open in IMG/M |
| 3300030796|Ga0265789_127319 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 545 | Open in IMG/M |
| 3300030860|Ga0074000_12837749 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 608 | Open in IMG/M |
| 3300030908|Ga0074005_10138321 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 1683 | Open in IMG/M |
| 3300030940|Ga0265740_1034521 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 575 | Open in IMG/M |
| 3300031026|Ga0315862_111895 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 579 | Open in IMG/M |
| 3300031231|Ga0170824_127467688 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 568 | Open in IMG/M |
| 3300031232|Ga0302323_100405665 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1441 | Open in IMG/M |
| 3300031469|Ga0170819_12535916 | Not Available | 615 | Open in IMG/M |
| 3300031791|Ga0316034_101509 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 976 | Open in IMG/M |
| 3300031815|Ga0316045_107648 | All Organisms → cellular organisms → Eukaryota | 1331 | Open in IMG/M |
| 3300031816|Ga0316042_122175 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 660 | Open in IMG/M |
| 3300031828|Ga0316043_114636 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 979 | Open in IMG/M |
| 3300032028|Ga0316052_111898 | Not Available | 563 | Open in IMG/M |
| 3300032515|Ga0348332_10429606 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 926 | Open in IMG/M |
| 3300032515|Ga0348332_11645843 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1553 | Open in IMG/M |
| 3300032592|Ga0214504_1059147 | Not Available | 752 | Open in IMG/M |
| 3300032592|Ga0214504_1100141 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 564 | Open in IMG/M |
| 3300032756|Ga0315742_11436771 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 731 | Open in IMG/M |
| 3300032821|Ga0314719_1042904 | Not Available | 552 | Open in IMG/M |
| 3300032828|Ga0335080_10269732 | All Organisms → cellular organisms → Eukaryota | 1855 | Open in IMG/M |
| 3300032893|Ga0335069_11169742 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum | 844 | Open in IMG/M |
| 3300033475|Ga0310811_10001958 | Not Available | 25581 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.06% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.30% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.55% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 4.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.03% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 3.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.27% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.27% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 2.27% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.52% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.52% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.52% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.76% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.76% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.76% |
| Leaf Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter | 0.76% |
| Rumen | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.76% |
| Clean Room | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000902 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 | Environmental | Open in IMG/M |
| 3300001085 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 | Environmental | Open in IMG/M |
| 3300001108 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 | Environmental | Open in IMG/M |
| 3300001134 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 | Environmental | Open in IMG/M |
| 3300001176 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 | Environmental | Open in IMG/M |
| 3300001179 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001738 | Marine viral communities from the Deep Pacific Ocean - MSP-118 | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300002875 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003220 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 | Environmental | Open in IMG/M |
| 3300003674 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300004130 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF226 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004132 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF240 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004134 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF248 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004135 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004136 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF214 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004213 | Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NA | Environmental | Open in IMG/M |
| 3300004294 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 33 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004473 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004474 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004487 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 38 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004526 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 116_HOW13 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004561 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004970 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005661 | Agave microbial communities from Guanajuato, Mexico - As.Sf.e | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006711 | Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP2255 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010080 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010113 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010123 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010192 | Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum fallax MT (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300011083 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013865 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In5p-11 gowning area SPAdes reassembly | Engineered | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018624 | Metatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-5 | Environmental | Open in IMG/M |
| 3300018760 | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000920 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021857 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022729 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 | Host-Associated | Open in IMG/M |
| 3300022750 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L149-409B-1 | Environmental | Open in IMG/M |
| 3300022932 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L074-202C-1 | Environmental | Open in IMG/M |
| 3300023063 | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-222 | Environmental | Open in IMG/M |
| 3300023267 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L197-509C-6 | Environmental | Open in IMG/M |
| 3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
| 3300023664 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023675 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023677 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024486 | Metatranscriptome of sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1766 RNA GHGlow gp2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300028674 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029983 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300030004 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030508 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300030561 | Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-2W (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300030579 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030583 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030612 | Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-1 (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030796 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030860 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030908 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031026 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T25 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031791 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031816 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032028 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032592 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032821 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12144J12865_1003611 | 3300000902 | Forest Soil | MSARCRLVNELVKLTNINLALKEPPINGGLTYEGPKVAEYPGR* |
| JGI12187J13240_1003691 | 3300001085 | Forest Soil | LSVISARCRLVNGFAKLTNISLALKETPMNGGPTYEGPKVAEYLGR* |
| JGI12647J13326_1023741 | 3300001108 | Forest Soil | ARCRLVNRFAKLTKIILALKETPINGGLTYEGPKVAEYPGR* |
| JGI12688J13320_1005182 | 3300001134 | Forest Soil | LSVISAXCRLVNGFAXLTXXXLXLKETPINGGLTDEGPKVAEYPGR* |
| JGI12655J13551_1011781 | 3300001176 | Forest Soil | VLSVNSARCRLVNGFAKLTNINLALKETPINGGLTDEGPKVAEYPGR* |
| JGI12660J13575_1000081 | 3300001179 | Forest Soil | LSVISAQCRLVNEFAKLTNIILALKETPINGGLTDEGPKVA |
| JGI12053J15887_101687062 | 3300001661 | Forest Soil | LSVISARCRLVNGLAKLTNTSLALKETPINGGFTDEGPKVAEYPGR* |
| C688J18823_100445987 | 3300001686 | Soil | LSVISAQCRLVNEYSKLTNISLDLKETPINGGLITEGPKVAEYPGR* |
| JGI24657J20077_10278532 | 3300001738 | Deep Ocean | NGFAKLTNISLALKETPINGGLTYEGPKVAEYPGR* |
| C687J26615_100019746 | 3300002121 | Soil | LSVISARCRLVNGFAKLTNISMALKETPINGGLISEGPKVAEYLGR* |
| Ga0006800J43185_1017821 | 3300002875 | Peatlands Soil | VISARCRLVNGFAKLTNISLALKETPINGGLTDEGPKVAEYPG |
| JGI26342J46808_10008121 | 3300003220 | Bog Forest Soil | LSVISARCRLVNEFAKLTNTSLALKETPINGGLTDEGPKVAEYPGR* |
| Ga0006876_1025921 | 3300003674 | Peatlands Soil | LSVISARCRLVNGFAKLTNISLALKETPINGGLTDEGPKVAEYPGR* |
| Ga0058895_11172711 | 3300004130 | Forest Soil | LSVISAQCRLVNELVKLIKINLILKETPINGGLTYKGPKVAEYPGR* |
| Ga0058902_10048232 | 3300004132 | Forest Soil | LSVISAQCRLVNGFAKLTNISMALKETPMNGGLINEGPKVAEYLGR* |
| Ga0058906_13481901 | 3300004134 | Forest Soil | MSARYRLVNGFAKLNKLGFEGTPINGGLTYEGPKVAEYPGR* |
| Ga0058884_10155792 | 3300004135 | Forest Soil | LSVNSARCRLVNGFAKLTNINLALKETPINGGLTYEGPKVAEYPGR* |
| Ga0058889_10317423 | 3300004136 | Forest Soil | LSVISARCRLVNGSAKLTNINLALKETPINGGLTDEGPKVAEYPGR* |
| Ga0058889_14208712 | 3300004136 | Forest Soil | MSARYRLVNGFAKLNKLGFEGSPINGGLTYEGPKVAEYPGR* |
| Ga0066648_101687241 | 3300004213 | Groundwater | MSAKSRLVNGFSKATNISLVLKETPSNSGLTYKGPKVAEFLGR* |
| Ga0068945_10017992 | 3300004294 | Peatlands Soil | LSVISARCRLVNGFAKLTNINLALKETPINGGLTYEGPKVAEYPGR* |
| Ga0068919_10097492 | 3300004473 | Peatlands Soil | LSVISAQCRLVNEFIKLIKINLILKETPINGGLTYKGPKVAEYPGR* |
| Ga0068968_15085861 | 3300004474 | Peatlands Soil | LSVISAQCRLVNEFIKLIKINLILKETPINGGLTYKGPKVA |
| Ga0068950_1815272 | 3300004487 | Peatlands Soil | LSVISARCRLVNGFAKLTNINLALKETPINGGLTDEGPKVAEYPGR* |
| Ga0066566_1039012 | 3300004526 | Freshwater Sediment | LSVISALCRLVNGFAEITICLALKETPINGGLTYEGPKVAEYLGR* |
| Ga0068921_10319781 | 3300004561 | Peatlands Soil | LSVISARCRLVNGLAKLTNISLALKETPINGGLNYKGPKVAEYPGR* |
| Ga0068921_12107301 | 3300004561 | Peatlands Soil | MNQRIGVISARCRLVNEFIKLTKISLVLKETPINGGLTYKGPKVAEYPGR* |
| Ga0058863_101154662 | 3300004799 | Host-Associated | LSVISARCRLVNGFAKLTNTGLALKETPINGGFTDEGPKVAEYPGR* |
| Ga0058860_121848151 | 3300004801 | Host-Associated | MSAQCRQGNGFILFLTKVLKDTPTNGGLTYEGPKVAEYLGR* |
| Ga0072320_10473761 | 3300004970 | Peatlands Soil | VISARCRLVNGFAMLTNISVALKETPINGGLTYEGPKVAEYPGR* |
| Ga0066677_103229001 | 3300005171 | Soil | LSVISAQCRLVNGFAKLTNISLALKETPINGGLTYEGPKVAEYPGR* |
| Ga0070666_102341941 | 3300005335 | Switchgrass Rhizosphere | LSVISALCRLANGFAKLTNTNLALKVNPDQWRPYNEGPKVAEYLGR* |
| Ga0070691_109406211 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | LSVISALCRLVNGFAKLTNTGLALKETPINGGLTYEGPKVAEYPGR* |
| Ga0070709_101032742 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LSVISARCRLVNEFAKLTNISLALKETPINGGLTDEGPKVAEYPGR* |
| Ga0070713_1004096771 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VISAQCRLVNEYTKLIKINLVLKETPMNGGLTYKGPKVAEYPGR* |
| Ga0070662_1002951922 | 3300005457 | Corn Rhizosphere | LSVISARCRLVNGFAKLTNTGLALKETPINGGFTDEGPKVA |
| Ga0070697_1014945101 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LSVISARCRLVNGFAKLTNISLALKETPINGGFTDEGPKVAEYPGR* |
| Ga0070730_100868341 | 3300005537 | Surface Soil | LSVISAQCRLVNGFAKLTNISLVLKETPINGGLTYEGPKVAEYPGR* |
| Ga0066704_100926781 | 3300005557 | Soil | LSVISARCRLVNGFAKLTNISLALKETPINGGLNYKGPKVAEYPGR* |
| Ga0066670_104626002 | 3300005560 | Soil | VISARCRLVNKLVKLTKINLAFKETPINGGLTYEGPKVAEYPGR* |
| Ga0058697_102760761 | 3300005562 | Agave | MSALYRLVNGFAQVTKITWALKEPPINGGLTYEGPKVAEYPGR* |
| Ga0066702_102124481 | 3300005575 | Soil | LSVISARCRLVNGFAKLTKISLVLKETPINGGLTDEGPKVAEYPGR* |
| Ga0068859_1001970251 | 3300005617 | Switchgrass Rhizosphere | LSVISARCRLVNGFAKLTNISLALKETPINGGLTYEGPKVAEYPGR* |
| Ga0058698_107673181 | 3300005661 | Agave | MSALYRLVNGFAFLTKIKKALKEPPINGGLTYEGPKVAEYPGR* |
| Ga0068860_1021398521 | 3300005843 | Switchgrass Rhizosphere | LSVISARCRLVNGFAKLTKISLALKETPINGGLTYEGPKVAEYLGR* |
| Ga0066787_101108501 | 3300005950 | Soil | LSVISAQCRLVNGFVKLTNISLALKETPINGGLIYKGPKVAEYLGR* |
| Ga0081540_11036033 | 3300005983 | Tabebuia Heterophylla Rhizosphere | LSVISARCRLVNGFAKLTNTSLALKETPINGGFTDEGPKVAEYPGR* |
| Ga0080027_100202232 | 3300005993 | Prmafrost Soil | MKKIEVLSVISAQCRLVNEFAMLTKISMVFKETPINGGLTDEGPKVAEYPGR* |
| Ga0075015_1008336111 | 3300006102 | Watersheds | LSVISARCRLVNGFAKLTKISMALKETPINGGLTYEGPKVAEYPGR* |
| Ga0070716_1000846492 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LSVISARCRLVNGFAKLTNISLALKETPINGGLTYEGPKVAEYLGR* |
| Ga0070765_1002674791 | 3300006176 | Soil | LSVISARCRLVNGFAKLTNIILALKETPINGGLTDEGPKVAEYPGR* |
| Ga0070765_1003486532 | 3300006176 | Soil | LSVISAQCRLVNGFAMLTNISMVLKETPINGGLTYKGPKVAEYPGR* |
| Ga0075521_105473751 | 3300006642 | Arctic Peat Soil | LSVISARCRLVNGFAKVTNIDLALKETPINGGLTYEGPKVAEYLGR* |
| Ga0031673_10456741 | 3300006711 | Deep Ocean | LVNGFAKLTNISLALKETPINGGLTYEGPKVAEYPGR* |
| Ga0066653_101229481 | 3300006791 | Soil | MSIKVLSVISARCRLVNGFFKLTKISLDLKETPINGGLTYEGPKVAEYPGR* |
| Ga0068865_1005889042 | 3300006881 | Miscanthus Rhizosphere | VISARCRLVNGFAKLTNISLALKETPINGGLTYEGPKVAEYPGR* |
| Ga0105241_101168491 | 3300009174 | Corn Rhizosphere | VISARCRLVNGFAKLTNTGLALKETPINGGFTDEGPKVAEYPGR* |
| Ga0127448_1622801 | 3300010080 | Grasslands Soil | VISAQCRLVNGFAKLTNISLALKETPINGGLTYEGPKVAEY |
| Ga0127444_11079931 | 3300010113 | Grasslands Soil | EYSMLTNISLDLKETPINGGLISEGPKVAEYPGR* |
| Ga0127479_10801591 | 3300010123 | Grasslands Soil | VMSARCRLVNGVTWLIKIGLVLKDTPVNGGLTYEGPKVAKFFGR* |
| Ga0127506_10130431 | 3300010192 | Host-Associated | VISARCRLVNGFSKLTNIGLVLKETPINGGLTDEGPKVAEYP |
| Ga0138560_10161461 | 3300011083 | Peatlands Soil | RCRLVNGFAMLTNISVALKETPINGGLTYEGPKVAEYPGR* |
| Ga0134024_13618931 | 3300012404 | Grasslands Soil | VISARCRLVNKLVKLTKINLAFKETPINGGLTYEGPKVAEYPG |
| Ga0138269_11574471 | 3300012778 | Freshwater Lake | VISARCRLVNGLAKLTNISLALKETPINGGLNYKGPKVA |
| Ga0157293_101373661 | 3300012898 | Soil | IKVLSVISARCRLVNGFSKLTNISLVLKETPINGGLTYEGPKVAEYLGR* |
| Ga0137407_104780161 | 3300012930 | Vadose Zone Soil | LSVISARCRLVNRFAKLTNINLALKETPINGGLTYEGPKVAEYLGR* |
| Ga0154017_174411 | 3300013041 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSVISARCRLVNGFAKLTNTGLALKETPINGGFTDEGPKVAEYPGR* |
| Ga0181471_1024382 | 3300013865 | Clean Room | MSALCRLVNGFAKLTNTGLALKETPINGGLTYEGPKVAEFLGR* |
| Ga0187786_101632201 | 3300017944 | Tropical Peatland | VISARCRLVNGFTKLTNTSLALKETPINGGFTDEGPKVAEYP |
| Ga0193577_1125521 | 3300018624 | Marine | VISARCRLVNGFANLTKIGLALKETPINGGLNDEGQTQSY |
| Ga0103504_100001912 | 3300018760 | Marine | EIKVLSVISARCRLVNGFAKLTNISLALKETPINGGLTYEGPKVAEYPGR |
| Ga0193726_11944512 | 3300020021 | Soil | VISAQCRLVNGFAKLTNTNLALKETPINGGLTDEGPKVAEYL |
| Ga0206354_116739281 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVNGFAKLTNTGLALKETPINGGFTDEGPKVAEYPGR |
| Ga0210395_103802351 | 3300020582 | Soil | VISARCRLVNGFAKLTNISLALKETPINGGLTDEGPKVAEYLGR |
| Ga0193694_10521571 | 3300021415 | Soil | VISARCRLVNGFAKLTNIDLALKETPINGGLTDEGP |
| Ga0213849_10747511 | 3300021857 | Watersheds | VISARCRLVNGFARLTNINLALKETPINGGLTDKGPKVAE |
| Ga0242649_10106131 | 3300022509 | Soil | VISARCRLVNGFAKLTKIGLALKETPINGGLTDEGPKVAEYPGR |
| Ga0242673_10682261 | 3300022716 | Soil | VISARCRLVNEFAKLTKISLVLKETPINGGLTYKGPKVAE |
| Ga0228599_1039461 | 3300022729 | Roots | VISAQCRLVNGFVKLTNISLALKETPINGGLIYKGPKV |
| Ga0247812_101475241 | 3300022750 | Plant Litter | VISALCRLVNGFAKLTNINLALKVNPDQWRPYNEGPKVAEYLGR |
| Ga0247807_100279601 | 3300022932 | Plant Litter | VISARCRLVNGFAKLTNISLALKETPINGGLTYEGPKVAEYPG |
| Ga0233335_10455632 | 3300023063 | Leaf Litter | VISALCRLVNGFAEITICLALKETPINGGLTYEGPKVA |
| Ga0247771_10618581 | 3300023267 | Plant Litter | VISARCRLVNGFAKLTNISLALKETPINGGLTYEGP |
| Ga0247776_100943951 | 3300023275 | Plant Litter | VISARCRLVNGFAKLTNISLALKETPINGGLTYEG |
| Ga0247527_1120721 | 3300023664 | Soil | RCRLVNGFAKLTNINLALKETPINDGLTDEGPKVAEYPGR |
| Ga0247533_1026371 | 3300023675 | Soil | AQCRLVNGFAKLTNINLALKETPINGGLTDEGPKVAEYPGR |
| Ga0247543_1005461 | 3300023677 | Soil | VISARCRLVNGFAKLTNINLALKETPINGGLTDEGPKVAEYP |
| Ga0255059_103730691 | 3300024486 | Rumen | RLVNGFAKLTNISLASKETPINGGFTYEGPKVAEYLGR |
| Ga0207656_100049891 | 3300025321 | Corn Rhizosphere | VISARCRLVNGFAKLTNTGLALKETPINGGFTDEGPKVAEYPGR |
| Ga0209863_100176701 | 3300026281 | Prmafrost Soil | MKKIEVLSVISAQCRLVNEFAMLTKISMVFKETPINGGLTDEGPKVAEYPGR |
| Ga0257157_10155271 | 3300026496 | Soil | VISARCRLVNEFAKLTNISLASKETPINGGLTYEG |
| Ga0302161_100006171 | 3300028674 | Fen | VNGFSKLTNISLVLKETPINGGLTYEGPKVAEYPGR |
| Ga0302219_100532841 | 3300028747 | Palsa | LVNGFAKLTNINLALKETPINGGLNYKGPKVAEYLGR |
| Ga0302197_104742171 | 3300028873 | Bog | NGFAKLTNISLALKETPINGGLTDEGPKVAEYLGR |
| Ga0302155_1000921011 | 3300028874 | Bog | VNGFAKLTNINLALKETPINGGLTDEGPKVAEYPGR |
| Ga0311329_102851551 | 3300029907 | Bog | VLSVISARCRLVNGFSKLTNISLVLKETPINGGLTYEGPKVAEYLGR |
| Ga0311358_103138511 | 3300029915 | Bog | VISARCRLVNGFSKLTNISLVLKETPINGGLTYEGPKVAEYLG |
| Ga0302284_10328291 | 3300029983 | Fen | NGLAKLTNISLASKETPINGGLNYKGPKVAEYPGR |
| Ga0302186_101283641 | 3300030004 | Bog | ARCRLVNGFAKLTNISLALKETPINGGLNDKGPKVAEYPGR |
| Ga0302178_103048501 | 3300030013 | Palsa | VISARCRLVNEFTKLTNISLVLKETPINGGLTYEGPKVAEYPGR |
| Ga0302185_101155631 | 3300030508 | Bog | VNGFAKLTNISLALKETPINGGLTDEGPKVAEYPGR |
| Ga0257200_10178541 | 3300030561 | Host-Associated | RLVNGFAEITICLALKETPINGGLTYEGPKVAEYLGR |
| Ga0247633_100905841 | 3300030579 | Soil | LRLKIKVLGVMSAKCRLVNGFAKETKLSLDLKETPINSGLNDEGPKVAEFLGR |
| Ga0311355_106080061 | 3300030580 | Palsa | VNSARCRLVNGFAKLTNINLALKETPINGGLNYKGPKV |
| Ga0210262_10817771 | 3300030583 | Soil | SVISARCRLVNGFSKLTNISLVLKETPINGGLTYKGPKVAEFLGR |
| Ga0257196_12003981 | 3300030612 | Host-Associated | VLSVISARCRLVNGFAKLTNISLALKETPINGGLTYEGPKVAEYPGR |
| Ga0311354_107390081 | 3300030618 | Palsa | CRLVNGFAKLTNISLALKETPINGGLTYEGPKVAEYPGR |
| Ga0311354_117744711 | 3300030618 | Palsa | VISTQCRLVNEFVNLTNINLALKETPINGGLAVEGLIVL |
| Ga0311345_105582332 | 3300030688 | Bog | NGFAKLTNISLALKETPINGGLTDEGPKVAEYPGR |
| Ga0302312_101079181 | 3300030746 | Palsa | VNSARCRLVNGFAKLTNINLALKETPINGGLTYEGPKV |
| Ga0265789_1273191 | 3300030796 | Plant Litter | LLSVISALYRLVNGFSLLTKIDEVLKETPINGGLTYKGLKVAEYPGR |
| Ga0074000_128377491 | 3300030860 | Soil | MSARCRLVNGFAKLTNTGLALKDTPINGGLTYEGPKVAEFLGR |
| Ga0074005_101383211 | 3300030908 | Soil | VISAQCRLVNGFAKLTNISMALKETPMNGGLISEGPKVAEYLGR |
| Ga0265740_10345211 | 3300030940 | Soil | ISAQCRLVNGFVKLTNISLTLKETPINGGLIYKGPKVAEYLGR |
| Ga0315862_1118951 | 3300031026 | Plant Litter | ALCVRCKIKVLSVMSALCRLANGFSRVTNIVLVLKEPPINGGLTYEGLKVAEFLGR |
| Ga0170824_1274676881 | 3300031231 | Forest Soil | VLSVISAQCRLVNGFSRLTNISLDLKETPINGGLTYEGPKVAEYPGR |
| Ga0302323_1004056651 | 3300031232 | Fen | VISARCRLVNGFAKLTNIDLALKETPINGGLTDEGPKVA |
| Ga0170819_125359161 | 3300031469 | Forest Soil | RKVNRFTWLTNISLVLKDSPVNGGLTYEGPKVAEYLGR |
| Ga0316034_1015091 | 3300031791 | Soil | LVNGFSKLTNIGLVLKETPINGGLTYEGPKVAEYLGR |
| Ga0316045_1076481 | 3300031815 | Soil | LVNGSAKLTNINLALKETPINGGLTDEGPKVAEYPGR |
| Ga0316042_1221751 | 3300031816 | Soil | RCRLVNGFAKLTNINLALKETPINGGLNYKGPKVAEYLGR |
| Ga0316043_1146361 | 3300031828 | Soil | VNSAQCRLVNGFAKLTNINLALKETPINGGLTDEGPKVAE |
| Ga0316052_1118981 | 3300032028 | Soil | VISAQCRLVNGFVKLTNISLALKETPINGGLIYKGPKVA |
| Ga0348332_104296061 | 3300032515 | Plant Litter | SARCRLVNRFAKLTKIDLALKETPINGGLTDEGPKVAEYPGR |
| Ga0348332_116458431 | 3300032515 | Plant Litter | VKVLSVNSALCRSANGFAKLVINLVMKDTPINGGLIYEGPKVAEYPGR |
| Ga0214504_10591471 | 3300032592 | Switchgrass Phyllosphere | VISARCRLVNGFSKLTNINLVLKETPINGGLTYEGPK |
| Ga0214504_11001412 | 3300032592 | Switchgrass Phyllosphere | VLSVMSALCRLVNGFSWLTSIDQVLKDTPINGGLSYEGLKVAEYPGR |
| Ga0315742_114367711 | 3300032756 | Forest Soil | VISARCRLVNGFAKSTNISLALKETPINGGLTYEGLKVAEYLGR |
| Ga0314719_10429041 | 3300032821 | Switchgrass Phyllosphere | VISALCRLANGFAKLTNISLVLKETPINGGLTYEGPKVA |
| Ga0335080_102697321 | 3300032828 | Soil | LVNEFAKLTNTSLVLKETPINGGFTDEGPKVAEYPGR |
| Ga0335069_111697421 | 3300032893 | Soil | VISAQCWLVNEFAILTNISLALKETPINGGLTYEGPKVAEY |
| Ga0310811_1000195817 | 3300033475 | Soil | VISARCRLANGFSKLVKGLVLKEPPVNGGLNVRVLR |
| ⦗Top⦘ |