3300022750: Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L149-409B-1

Overview

Basic Information

• IMG/M Taxon OID: 3300022750
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0095510 | Gp0290982 | Ga0247812
• Sample Name: Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L149-409B-1
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 750494808
• Sequencing Scaffolds: 4
• Novel Protein Genes: 4
• Associated Families: 4

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria	1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → agricultural field → plant litter
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.3
  • Long. (^o): -89.38
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049431	Metagenome / Metatranscriptome	146	N
F051903	Metagenome / Metatranscriptome	143	Y
F061214	Metagenome / Metatranscriptome	132	Y
F088701	Metagenome / Metatranscriptome	109	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0247812_10052235	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima	1898
Ga0247812_10147178	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria	946
Ga0247812_10147524	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	944
Ga0247812_10295460	Not Available	590

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0247812_10052235	Ga0247812_100522351	F049431	MTTGRINQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0247812_10147178	Ga0247812_101471781	F051903	MCEEIATVRRKFQRIGTRRILVLDETHRRIGDVTERTIVLPGEPSTIETSATTHYAPRYDMIACCTSKEVMPPMIYAPKERGKGIDTEMLLQYIRNLLAQSAGALDRYPLFLMLDKSTIHNEGKIIETFHDWGCQELVEVIKMPTAAAKRLSPLDNSLFNVWRQRALNGPPLTRTNIKQRMSDAWNSITERDLLPQYRHCGLMRHQDVYFDCPNPATHRHGS
Ga0247812_10147524	Ga0247812_101475241	F061214	VISALCRLVNGFAKLTNINLALKVNPDQWRPYNEGPKVAEYLGR
Ga0247812_10295460	Ga0247812_102954601	F088701	VALNKPEKIPIPVFKKKKYKLSYVIKVEITKIEIVALEYNIDLSRLSVIEFDNSSIINDNVNI