| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300018624 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0129122 | Gp0217197 | Ga0193577 |
| Sample Name | Metatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-5 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Woods Hole Oceanographic Institution |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 19263251 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Metatranscriptome Of Marine Microbial Communities From Deep Sea Water Colum In Eastern Mediterranean Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Deep Sea Water Colum In Eastern Mediterranean Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | mediterranean sea biome → marine benthic feature → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Eastern Mediterranean Sea | |||||||
| Coordinates | Lat. (o) | 36.29 | Long. (o) | 15.39 | Alt. (m) | N/A | Depth (m) | 2200 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061214 | Metagenome / Metatranscriptome | 132 | Y |
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0193577_107995 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| Ga0193577_112552 | Not Available | 501 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0193577_107995 | Ga0193577_1079951 | F077438 | VERPFTQSRFETLFLWNLQVEISSDLMPTVEKEIS |
| Ga0193577_112552 | Ga0193577_1125521 | F061214 | VISARCRLVNGFANLTKIGLALKETPINGGLNDEGQTQSY |
| ⦗Top⦘ |