Basic Information | |
---|---|
IMG/M Taxon OID | 3300022932 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0290977 | Ga0247807 |
Sample Name | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L074-202C-1 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 850068750 |
Sequencing Scaffolds | 6 |
Novel Protein Genes | 6 |
Associated Families | 5 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 1 |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria | 1 |
All Organisms → cellular organisms → Bacteria | 1 |
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → agricultural field → plant litter |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003605 | Metagenome / Metatranscriptome | 477 | Y |
F004023 | Metagenome / Metatranscriptome | 456 | Y |
F051903 | Metagenome / Metatranscriptome | 143 | Y |
F061214 | Metagenome / Metatranscriptome | 132 | Y |
F085909 | Metagenome | 111 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0247807_10000498 | Not Available | 24331 | Open in IMG/M |
Ga0247807_10027960 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 2355 | Open in IMG/M |
Ga0247807_10128121 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria | 1034 | Open in IMG/M |
Ga0247807_10188365 | Not Available | 838 | Open in IMG/M |
Ga0247807_10249979 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
Ga0247807_10430309 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 521 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0247807_10000498 | Ga0247807_100004983 | F003605 | MAVGDDATAAGYPLVPNTGEEGRVRFGAREINRTRDLIAGVRGLIPIGKAGYRSAAGITTSAVDPVNTDGQDGDIHIKTLA |
Ga0247807_10027960 | Ga0247807_100279601 | F061214 | VISARCRLVNGFAKLTNISLALKETPINGGLTYEGPKVAEYPG |
Ga0247807_10128121 | Ga0247807_101281211 | F051903 | MCEEIATVRRKFQRIGTRRILVLDETHRRIGDVTERTIVLPGEPSTIETSATTHYAPRYDMIACCTSKEVMPPMIYAPKERGKGVDTEMLLQYIRNLLAQSAGALDRYPLFLMLDKSTIHNEGKIIETFHDWGCQELVEVIKMPTAAAKRLSPLDNSLFNVWRQRALNGPPLTRTNIKQRMSDAWNSITEQDLLPQYRHCGLMRRQDVYFDCPNPAAHRHRS |
Ga0247807_10188365 | Ga0247807_101883651 | F051903 | AEVRRKVQRVGKDKVLFLDETHKRVGDATTNTIVLPGEPSFIQSDETSKYAPRFDMIACCSGKEVLPPIIYAPKEGGKGINAAMLHEYIRQLLGQAAGALDRYPLILVLDRATIHSEEKMLQEFHDWGCQELKEIVKMPTAAAKRLSPLDNSLFNVWRRRVLEGPPLTQADIKQRMSDAWNSITAADLNAQYHNCGLFRGEDVYFDCPNPAVHRHSS |
Ga0247807_10249979 | Ga0247807_102499791 | F085909 | MAVDEVELNALAQASKQSRAVSGKDRLYKEFVLVDQSQICQSQ |
Ga0247807_10430309 | Ga0247807_104303091 | F004023 | QVVTFFGLVLCCTHLSEITLTIAANVVHTLFLFHGKFYWXIFTDKNLNTDTLIRLAYAHYLSAFYMAYLGLLHGIDMHYDXKNESIYDGLEPEMSWXDEALSNELGTFIEAVFVLNIICWXMYPEPEALSYEIFMXGDIGLIPDVRFYGVAPHXYFRPFMAWLIVCPHHKTGI |
⦗Top⦘ |