3300007218: Pinova apple microbial communities from Italy

Overview

Basic Information

• IMG/M Taxon OID: 3300007218
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117937 | Gp0125972 | Ga0103964
• Sample Name: Pinova apple microbial communities from Italy
• Sequencing Status: Permanent Draft
• Sequencing Center: Illumina
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 258270869
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima	1
Not Available	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Alternaria → Alternaria sect. Alternaria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Insights Gained From Metagenomic Shotgun Sequencing Of Apple Fruit Epiphytic Microbiota
• Type: Host-Associated
• Taxonomy: Host-Associated → Plants → Phyllosphere → Carposphere → Unclassified → Fruit → Insights Gained From Metagenomic Shotgun Sequencing Of Apple Fruit Epiphytic Microbiota

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface

Location Information

• Location: Italy
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049431	Metagenome / Metatranscriptome	146	N
F088701	Metagenome / Metatranscriptome	109	N
F102612	Metagenome / Metatranscriptome	101	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0103964_1032604	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima	1545
Ga0103964_1054821	Not Available	629
Ga0103964_1055831	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Alternaria → Alternaria sect. Alternaria	8464

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103964_1032604	Ga0103964_10326041	F049431	INQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK*
Ga0103964_1054821	Ga0103964_10548211	F088701	VAVVLKRPEKIPIPLFKXXXXXXXXXXXXIVALEYKIDLSRLSVMELDKSKKINDVINT*
Ga0103964_1055831	Ga0103964_10558316	F102612	MSSPAQPSPQVLQAYHQRLETLYSSLPDLLTTEQEDKTGTEALEQDVGKLDVKEQNLEDRVNKYCQEFLYIGGPTPYKRDLTST*