| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300023099 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0290973 | Ga0247803 |
| Sample Name | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L014-104B-1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 637855321 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria | 1 |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → agricultural field → plant litter |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034190 | Metagenome / Metatranscriptome | 175 | Y |
| F041209 | Metagenome / Metatranscriptome | 160 | Y |
| F045048 | Metagenome / Metatranscriptome | 153 | Y |
| F049431 | Metagenome / Metatranscriptome | 146 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0247803_1098992 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria | 1016 | Open in IMG/M |
| Ga0247803_1112203 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima | 946 | Open in IMG/M |
| Ga0247803_1176821 | Not Available | 731 | Open in IMG/M |
| Ga0247803_1218235 | Not Available | 648 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0247803_1098992 | Ga0247803_10989922 | F041209 | VSSAACEEIAELRRKLQRKRIGHVLFLDETALRLSAAPLRTLVLPHQQPYVVATETSTYAARFDMIACCTSDRVLIPKIFTPSERKGADVKGINGPMLKQFINDILAQAVERLDRYPLTLVLDKAAIHKNTEALLQEFYDRGSQSIKEILLMPPNAAKRMSPLDNALFHDWKEECRKHPPATKKTIQRIMSDAWNKMKPKSHYKHCGLTRNVDPYFDCPAPDIHRHGS |
| Ga0247803_1112203 | Ga0247803_11122031 | F049431 | EAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK |
| Ga0247803_1176821 | Ga0247803_11768212 | F045048 | SRASIPIGGHIAPNSTAGERALWKNVQNMAKKNKASDTINKPTPMFNPLCTDKVWLPK |
| Ga0247803_1218235 | Ga0247803_12182351 | F034190 | LHELNGPEISKFIKQERSTGALAAAGASTSLTDSVKASHSVLSRWLQQLHHSLLRSGDWTSADIDAWRAAVDDIQQHWRAEAQSKPFPKLHMLRHSVEFAERHRFLGRASEAQIESHHAAFNALFHKQHRNQSGNVSERLRRSLADAALRAVQPFLQQ |
| ⦗Top⦘ |