NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300023099

3300023099: Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L014-104B-1



Overview

Basic Information
IMG/M Taxon OID3300023099 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0290973 | Ga0247803
Sample NamePlant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L014-104B-1
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size637855321
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldplant litter
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Wisconsin
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034190Metagenome / Metatranscriptome175Y
F041209Metagenome / Metatranscriptome160Y
F045048Metagenome / Metatranscriptome153Y
F049431Metagenome / Metatranscriptome146N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0247803_1098992All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria1016Open in IMG/M
Ga0247803_1112203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima946Open in IMG/M
Ga0247803_1176821Not Available731Open in IMG/M
Ga0247803_1218235Not Available648Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0247803_1098992Ga0247803_10989922F041209VSSAACEEIAELRRKLQRKRIGHVLFLDETALRLSAAPLRTLVLPHQQPYVVATETSTYAARFDMIACCTSDRVLIPKIFTPSERKGADVKGINGPMLKQFINDILAQAVERLDRYPLTLVLDKAAIHKNTEALLQEFYDRGSQSIKEILLMPPNAAKRMSPLDNALFHDWKEECRKHPPATKKTIQRIMSDAWNKMKPKSHYKHCGLTRNVDPYFDCPAPDIHRHGS
Ga0247803_1112203Ga0247803_11122031F049431EAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0247803_1176821Ga0247803_11768212F045048SRASIPIGGHIAPNSTAGERALWKNVQNMAKKNKASDTINKPTPMFNPLCTDKVWLPK
Ga0247803_1218235Ga0247803_12182351F034190LHELNGPEISKFIKQERSTGALAAAGASTSLTDSVKASHSVLSRWLQQLHHSLLRSGDWTSADIDAWRAAVDDIQQHWRAEAQSKPFPKLHMLRHSVEFAERHRFLGRASEAQIESHHAAFNALFHKQHRNQSGNVSERLRRSLADAALRAVQPFLQQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.