NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022466

3300022466: Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12SEP2016_LR1 MT pilot (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300022466 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128851 | Gp0211512 | Ga0213504
Sample NameMetatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12SEP2016_LR1 MT pilot (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size10467752
Sequencing Scaffolds11
Novel Protein Genes13
Associated Families12

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Ustilaginomycotina → Ustilaginomycetes → Ustilaginales → Ustilaginaceae → Ustilago → Ustilago bromivora1
Not Available3
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Variosea → Cavosteliida → Cavosteliaceae → Planoprotostelium → Planoprotostelium fungivorum1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Amabiliviricetes → Wolframvirales → Narnaviridae → unclassified Narnaviridae → Botrytis cinerea binarnavirus 51

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant surface

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.39Long. (o)-85.37Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009305Metagenome / Metatranscriptome319Y
F014470Metatranscriptome262Y
F019067Metagenome / Metatranscriptome231Y
F021791Metagenome / Metatranscriptome217Y
F022892Metagenome / Metatranscriptome212Y
F025200Metagenome / Metatranscriptome202Y
F030315Metagenome / Metatranscriptome185Y
F040414Metagenome / Metatranscriptome161Y
F049431Metagenome / Metatranscriptome146N
F056211Metagenome / Metatranscriptome137Y
F062397Metagenome / Metatranscriptome130Y
F068385Metagenome / Metatranscriptome124Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0213504_100121All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Ustilaginomycotina → Ustilaginomycetes → Ustilaginales → Ustilaginaceae → Ustilago → Ustilago bromivora2449Open in IMG/M
Ga0213504_101381Not Available945Open in IMG/M
Ga0213504_102907Not Available691Open in IMG/M
Ga0213504_103092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima676Open in IMG/M
Ga0213504_103753Not Available624Open in IMG/M
Ga0213504_103852All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Variosea → Cavosteliida → Cavosteliaceae → Planoprotostelium → Planoprotostelium fungivorum617Open in IMG/M
Ga0213504_104444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
Ga0213504_104468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea580Open in IMG/M
Ga0213504_105199All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae544Open in IMG/M
Ga0213504_105530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum532Open in IMG/M
Ga0213504_105551All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Amabiliviricetes → Wolframvirales → Narnaviridae → unclassified Narnaviridae → Botrytis cinerea binarnavirus 5531Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0213504_100121Ga0213504_1001213F022892AHSIGTVILRLPPYAVASQEKILIPVGTAMIIVAAVK
Ga0213504_101381Ga0213504_1013812F068385EKLMINLVSYEMRKETHQFGTTMRAKDSILKVKDLSSLKCHKEMKDTXFR
Ga0213504_102907Ga0213504_1029071F021791VRFCADYRIKPHVPPFEQIPANSVKFQPCDCTAQAEYLKR
Ga0213504_102907Ga0213504_1029072F030315VIKYNEFVSIIKYEGISLIKNDIDALKYKNRIGLDTLLVYTIKYEY
Ga0213504_103092Ga0213504_1030921F049431TGRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0213504_103753Ga0213504_1037532F030315MKYIEFIIIINYENILLLKNDIEVLKYNYRIGLDTLLVYTVKYEYIINLLKLTF
Ga0213504_103852Ga0213504_1038521F056211ADSQINNTLNVPNENMNTSITKSTTATGTGVSRGKGDVWHPYINDPSYGQRLLEVVSFLIILAAIPAFLGGVYSCFVMAYGAALGLLGMHAWTRRHALIFIISAAVFGVWLVVVIILNAVRDVSTVVPFYSDVVIASTRYSSGQYNGSRIFAYIDHGILIVLTAIAFFTAIKVAGERRPEPGTLVHQTTTSTTNVPQSV
Ga0213504_104444Ga0213504_1044442F062397MCMNGLRINMGFGPSFGLWPSSFSVLALDHGPRHFMLQNRPKTYKNEVPPKYMCKCENDQ
Ga0213504_104468Ga0213504_1044681F009305LIRLAYAHYLSAFYMAYLGLLHGIDMHYDXKNESTYDGLEPEMSXXDEALGNELGTFIEALVILNIVCWXLYPEPEALSYEIFMXGDIGMVSDVRFYGVAPHWYFRPYMAWLIVCPHHKTGIFGLALFFFALFHQPTLHGFNENGSYYKRRLLFSANKLKQKTFYKQSNLNVELNLFFQTTYALFVMCALYT
Ga0213504_105199Ga0213504_1051991F040414TSVCVNARQTSVDLVAASDGLDLRVSEAILDALFFTSVKIPRSLRAFAKSSLRPWFQGSRGKPVRVNHGQMQGAYLSFPLLCLHSYCAATWADRFDKEARFLVNGDDTVISAYRDVTVQDYPSGYRLNNDKTIRAGNAAEVNSTVFLKSKGRWREVRHLRRGGAVADYPGMLHMAKAVTI
Ga0213504_105530Ga0213504_1055301F025200LRPLHVGDDVLGHPNGAVPTTFLLPNLVSNHLAICFLLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0213504_105551Ga0213504_1055511F019067NVTLTGRGTKVLGREVGDDRVDLSRTPDALCATLVVQEDVIKMITSPEDTSIRKKSWNFCEVTSGPLTDPTQGFDHIRKDGDFTNLGFNDSVILRIILDVQKGEGEEHSSTQPGKMSMLGSRLATPRRENRGLWMIASIFQDSMLCTHKASEPKYLPPIMGGTGVTALFDNPNNVF
Ga0213504_106074Ga0213504_1060741F014470LRSVQWKHGRWGGAKRDVFSPSCGKVRRSYHYRARPGFAYLSFVGPGRPKLSPLWEKGADWGLVPASFQTEEEERGLAELEQFRRNWDSGFISVGD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.