| Basic Information | |
|---|---|
| Family ID | F048676 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 45 residues |
| Representative Sequence | RLCGTASDAVDAVKLEIPQGFKLLKFKMSEYLKYIVKLTISKI |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 26.35 % |
| % of genes near scaffold ends (potentially truncated) | 66.89 % |
| % of genes from short scaffolds (< 2000 bps) | 80.41 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.378 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands (34.459 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.649 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (44.595 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 4.08 |
| PF08240 | ADH_N | 2.72 |
| PF13458 | Peripla_BP_6 | 2.04 |
| PF00440 | TetR_N | 2.04 |
| PF08448 | PAS_4 | 1.36 |
| PF02706 | Wzz | 1.36 |
| PF00121 | TIM | 1.36 |
| PF00226 | DnaJ | 1.36 |
| PF00437 | T2SSE | 1.36 |
| PF01180 | DHO_dh | 1.36 |
| PF02470 | MlaD | 1.36 |
| PF02739 | 5_3_exonuc_N | 1.36 |
| PF03358 | FMN_red | 1.36 |
| PF08241 | Methyltransf_11 | 1.36 |
| PF13487 | HD_5 | 1.36 |
| PF00155 | Aminotran_1_2 | 1.36 |
| PF08843 | AbiEii | 1.36 |
| PF13439 | Glyco_transf_4 | 1.36 |
| PF02775 | TPP_enzyme_C | 1.36 |
| PF17147 | PFOR_II | 0.68 |
| PF12849 | PBP_like_2 | 0.68 |
| PF13692 | Glyco_trans_1_4 | 0.68 |
| PF01408 | GFO_IDH_MocA | 0.68 |
| PF03447 | NAD_binding_3 | 0.68 |
| PF03992 | ABM | 0.68 |
| PF02954 | HTH_8 | 0.68 |
| PF00463 | ICL | 0.68 |
| PF13280 | WYL | 0.68 |
| PF06508 | QueC | 0.68 |
| PF13616 | Rotamase_3 | 0.68 |
| PF02649 | GCHY-1 | 0.68 |
| PF00773 | RNB | 0.68 |
| PF03734 | YkuD | 0.68 |
| PF09957 | VapB_antitoxin | 0.68 |
| PF12850 | Metallophos_2 | 0.68 |
| PF04073 | tRNA_edit | 0.68 |
| PF00884 | Sulfatase | 0.68 |
| PF08447 | PAS_3 | 0.68 |
| PF00977 | His_biosynth | 0.68 |
| PF16925 | TetR_C_13 | 0.68 |
| PF01475 | FUR | 0.68 |
| PF00266 | Aminotran_5 | 0.68 |
| PF02661 | Fic | 0.68 |
| PF00589 | Phage_integrase | 0.68 |
| PF01613 | Flavin_Reduct | 0.68 |
| PF05157 | T2SSE_N | 0.68 |
| PF13419 | HAD_2 | 0.68 |
| PF00710 | Asparaginase | 0.68 |
| PF04976 | DmsC | 0.68 |
| PF14520 | HHH_5 | 0.68 |
| PF00682 | HMGL-like | 0.68 |
| PF13602 | ADH_zinc_N_2 | 0.68 |
| PF13660 | DUF4147 | 0.68 |
| PF02771 | Acyl-CoA_dh_N | 0.68 |
| PF02091 | tRNA-synt_2e | 0.68 |
| PF00144 | Beta-lactamase | 0.68 |
| PF02803 | Thiolase_C | 0.68 |
| PF10881 | DUF2726 | 0.68 |
| PF00158 | Sigma54_activat | 0.68 |
| PF02321 | OEP | 0.68 |
| PF01967 | MoaC | 0.68 |
| PF04715 | Anth_synt_I_N | 0.68 |
| PF00999 | Na_H_Exchanger | 0.68 |
| PF02653 | BPD_transp_2 | 0.68 |
| PF01797 | Y1_Tnp | 0.68 |
| PF05724 | TPMT | 0.68 |
| PF02021 | UPF0102 | 0.68 |
| PF00497 | SBP_bac_3 | 0.68 |
| PF04199 | Cyclase | 0.68 |
| PF10589 | NADH_4Fe-4S | 0.68 |
| PF03266 | NTPase_1 | 0.68 |
| PF12706 | Lactamase_B_2 | 0.68 |
| PF02780 | Transketolase_C | 0.68 |
| PF03840 | SecG | 0.68 |
| PF13380 | CoA_binding_2 | 0.68 |
| PF00881 | Nitroreductase | 0.68 |
| PF13188 | PAS_8 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 1.36 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 1.36 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 1.36 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.36 |
| COG3206 | Exopolysaccharide export protein/domain GumC/Wzc1 | Cell wall/membrane/envelope biogenesis [M] | 1.36 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.36 |
| COG3524 | Capsule polysaccharide export protein KpsE/RkpR | Cell wall/membrane/envelope biogenesis [M] | 1.36 |
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 1.36 |
| COG3765 | LPS O-antigen chain length determinant protein, WzzB/FepE family | Cell wall/membrane/envelope biogenesis [M] | 1.36 |
| COG3944 | Capsular polysaccharide biosynthesis protein YveK | Cell wall/membrane/envelope biogenesis [M] | 1.36 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 1.36 |
| COG0149 | Triosephosphate isomerase | Carbohydrate transport and metabolism [G] | 1.36 |
| COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 1.36 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.36 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 1.36 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.68 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.68 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.68 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.68 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.68 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG2224 | Isocitrate lyase | Energy production and conversion [C] | 0.68 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.68 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.68 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.68 |
| COG3302 | DMSO reductase anchor subunit DmsC | Energy production and conversion [C] | 0.68 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.68 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.68 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.68 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.68 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.68 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.68 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0315 | Molybdenum cofactor biosynthesis enzyme MoaC | Coenzyme transport and metabolism [H] | 0.68 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.68 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.68 |
| COG1618 | Nucleoside-triphosphatase THEP1 | Nucleotide transport and metabolism [F] | 0.68 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.68 |
| COG0752 | Glycyl-tRNA synthetase, alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 0.68 |
| COG1314 | Protein translocase subunit SecG | Intracellular trafficking, secretion, and vesicular transport [U] | 0.68 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.68 |
| COG1469 | GTP cyclohydrolase FolE2 | Coenzyme transport and metabolism [H] | 0.68 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.38 % |
| Unclassified | root | N/A | 21.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001371|BBDRAFT_10344861 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300001371|BBDRAFT_10412814 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300002231|KVRMV2_100163913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp. | 913 | Open in IMG/M |
| 3300002495|BRMGV_1025655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2420 | Open in IMG/M |
| 3300003988|Ga0055475_10053158 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300003988|Ga0055475_10062425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans | 1097 | Open in IMG/M |
| 3300003988|Ga0055475_10255477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → unclassified Nostoc → Nostoc sp. CHAB 5844 | 559 | Open in IMG/M |
| 3300003989|Ga0055473_10201281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 645 | Open in IMG/M |
| 3300003990|Ga0055455_10237770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 576 | Open in IMG/M |
| 3300004001|Ga0055450_10010626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2793 | Open in IMG/M |
| 3300004004|Ga0055451_10200187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 817 | Open in IMG/M |
| 3300004014|Ga0055456_10315630 | Not Available | 557 | Open in IMG/M |
| 3300004014|Ga0055456_10341215 | Not Available | 537 | Open in IMG/M |
| 3300004018|Ga0055452_10060727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1169 | Open in IMG/M |
| 3300004018|Ga0055452_10209074 | Not Available | 652 | Open in IMG/M |
| 3300004018|Ga0055452_10344216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 505 | Open in IMG/M |
| 3300004026|Ga0055443_10030111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1264 | Open in IMG/M |
| 3300004028|Ga0055447_10260328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 578 | Open in IMG/M |
| 3300004030|Ga0055444_10018582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 2009 | Open in IMG/M |
| 3300004051|Ga0055492_10158660 | Not Available | 543 | Open in IMG/M |
| 3300004074|Ga0055518_10197795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis | 526 | Open in IMG/M |
| 3300004075|Ga0055519_10072540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 714 | Open in IMG/M |
| 3300004077|Ga0055523_10080126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis | 732 | Open in IMG/M |
| 3300004077|Ga0055523_10151705 | Not Available | 579 | Open in IMG/M |
| 3300004146|Ga0055495_10062985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 804 | Open in IMG/M |
| 3300004147|Ga0055515_10020940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1249 | Open in IMG/M |
| 3300004330|Ga0065200_1213744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1367 | Open in IMG/M |
| 3300005215|Ga0069001_10010405 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300005215|Ga0069001_10111219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 717 | Open in IMG/M |
| 3300005215|Ga0069001_10220510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis | 542 | Open in IMG/M |
| 3300005590|Ga0070727_10038537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2947 | Open in IMG/M |
| 3300005600|Ga0070726_10034266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2947 | Open in IMG/M |
| 3300005601|Ga0070722_10053475 | Not Available | 1444 | Open in IMG/M |
| 3300005832|Ga0074469_10051526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis | 1598 | Open in IMG/M |
| 3300005832|Ga0074469_10386796 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300005917|Ga0075115_10117990 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300005917|Ga0075115_10252371 | Not Available | 602 | Open in IMG/M |
| 3300005919|Ga0075114_10022475 | All Organisms → cellular organisms → Bacteria | 2658 | Open in IMG/M |
| 3300005920|Ga0070725_10101905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1238 | Open in IMG/M |
| 3300005920|Ga0070725_10572218 | Not Available | 512 | Open in IMG/M |
| 3300007896|Ga0111484_1115263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 518 | Open in IMG/M |
| 3300009033|Ga0102956_1130482 | Not Available | 814 | Open in IMG/M |
| 3300009033|Ga0102956_1153473 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 754 | Open in IMG/M |
| 3300009033|Ga0102956_1197784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 669 | Open in IMG/M |
| 3300009033|Ga0102956_1233302 | Not Available | 620 | Open in IMG/M |
| 3300009033|Ga0102956_1307020 | Not Available | 548 | Open in IMG/M |
| 3300009035|Ga0102958_1116490 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300009035|Ga0102958_1347193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 525 | Open in IMG/M |
| 3300009060|Ga0102962_1022122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp. | 1889 | Open in IMG/M |
| 3300009060|Ga0102962_1038996 | Not Available | 1372 | Open in IMG/M |
| 3300009061|Ga0102938_10166902 | Not Available | 1207 | Open in IMG/M |
| 3300009127|Ga0118724_1136216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1329 | Open in IMG/M |
| 3300009127|Ga0118724_1138012 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300009145|Ga0102961_1043597 | Not Available | 1041 | Open in IMG/M |
| 3300009145|Ga0102961_1130749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 661 | Open in IMG/M |
| 3300009314|Ga0117908_1010062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15087 | Open in IMG/M |
| 3300009314|Ga0117908_1010062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15087 | Open in IMG/M |
| 3300009314|Ga0117908_1013821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 11729 | Open in IMG/M |
| 3300009506|Ga0118657_10001954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 36878 | Open in IMG/M |
| 3300009506|Ga0118657_10278721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 7133 | Open in IMG/M |
| 3300009506|Ga0118657_10302503 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
| 3300009506|Ga0118657_10351759 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300009506|Ga0118657_12641707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 563 | Open in IMG/M |
| 3300009509|Ga0123573_10780992 | Not Available | 896 | Open in IMG/M |
| 3300009788|Ga0114923_10216486 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300010392|Ga0118731_107784830 | Not Available | 642 | Open in IMG/M |
| 3300010412|Ga0136852_11468591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 646 | Open in IMG/M |
| 3300010413|Ga0136851_10009838 | All Organisms → cellular organisms → Bacteria | 11132 | Open in IMG/M |
| 3300010413|Ga0136851_10628081 | Not Available | 1062 | Open in IMG/M |
| 3300010413|Ga0136851_10748363 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300010413|Ga0136851_11072115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300010413|Ga0136851_11368422 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010430|Ga0118733_102584041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1003 | Open in IMG/M |
| 3300014305|Ga0075349_1111772 | Not Available | 612 | Open in IMG/M |
| 3300019700|Ga0194006_1049065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 524 | Open in IMG/M |
| 3300019708|Ga0194016_1040019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 573 | Open in IMG/M |
| 3300019727|Ga0193976_1033488 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300022217|Ga0224514_10109880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 952 | Open in IMG/M |
| 3300022218|Ga0224502_10237588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium PC51MH44 | 700 | Open in IMG/M |
| 3300022220|Ga0224513_10014369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2897 | Open in IMG/M |
| 3300022307|Ga0224507_10235007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium PC51MH44 | 734 | Open in IMG/M |
| 3300022860|Ga0222698_1021950 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300022860|Ga0222698_1035611 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10080266 | Not Available | 1153 | Open in IMG/M |
| 3300025556|Ga0210120_1026199 | Not Available | 1134 | Open in IMG/M |
| 3300025557|Ga0210141_1038011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 920 | Open in IMG/M |
| 3300025557|Ga0210141_1044079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 850 | Open in IMG/M |
| 3300025564|Ga0210084_1000411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8438 | Open in IMG/M |
| 3300025564|Ga0210084_1007207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2018 | Open in IMG/M |
| 3300025565|Ga0210110_1083631 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300025583|Ga0210085_1000019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 83627 | Open in IMG/M |
| 3300025583|Ga0210085_1137149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 655 | Open in IMG/M |
| 3300025599|Ga0210074_1048477 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300025649|Ga0208279_1012855 | All Organisms → cellular organisms → Bacteria | 2957 | Open in IMG/M |
| 3300025799|Ga0210122_1010120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2549 | Open in IMG/M |
| 3300025799|Ga0210122_1074030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 765 | Open in IMG/M |
| 3300025799|Ga0210122_1100569 | Not Available | 637 | Open in IMG/M |
| 3300025801|Ga0210097_1180267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 500 | Open in IMG/M |
| 3300025802|Ga0210111_1016178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1932 | Open in IMG/M |
| 3300025813|Ga0210064_1141612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → unclassified Nostoc → Nostoc sp. CHAB 5844 | 578 | Open in IMG/M |
| 3300025814|Ga0210101_1059391 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300025817|Ga0210144_1003392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 5952 | Open in IMG/M |
| 3300025969|Ga0210080_1016811 | Not Available | 939 | Open in IMG/M |
| 3300025970|Ga0210081_1071354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium IS3 | 512 | Open in IMG/M |
| 3300025977|Ga0210072_1002555 | Not Available | 1997 | Open in IMG/M |
| 3300025983|Ga0210106_1022643 | Not Available | 990 | Open in IMG/M |
| 3300025983|Ga0210106_1024240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 960 | Open in IMG/M |
| 3300025983|Ga0210106_1038066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 776 | Open in IMG/M |
| 3300025984|Ga0210082_1001323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 3508 | Open in IMG/M |
| 3300025984|Ga0210082_1010929 | Not Available | 1370 | Open in IMG/M |
| 3300026352|Ga0210107_1034077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 778 | Open in IMG/M |
| 3300027917|Ga0209536_100204376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2480 | Open in IMG/M |
| 3300027917|Ga0209536_100326317 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300029827|Ga0134606_10035170 | Not Available | 1707 | Open in IMG/M |
| 3300031256|Ga0315556_1159458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300031277|Ga0307425_1063677 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300031277|Ga0307425_1125921 | Not Available | 809 | Open in IMG/M |
| 3300031371|Ga0307423_1004409 | All Organisms → cellular organisms → Bacteria | 7060 | Open in IMG/M |
| 3300031371|Ga0307423_1114612 | Not Available | 799 | Open in IMG/M |
| 3300031552|Ga0315542_1013948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3862 | Open in IMG/M |
| 3300031578|Ga0307376_10276931 | Not Available | 1126 | Open in IMG/M |
| 3300031665|Ga0316575_10002358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6325 | Open in IMG/M |
| 3300031665|Ga0316575_10008695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3704 | Open in IMG/M |
| 3300031665|Ga0316575_10077440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1339 | Open in IMG/M |
| 3300031665|Ga0316575_10130406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1031 | Open in IMG/M |
| 3300031691|Ga0316579_10250923 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium DG_23 | 856 | Open in IMG/M |
| 3300031691|Ga0316579_10299446 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031691|Ga0316579_10342503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter cummioxidans | 723 | Open in IMG/M |
| 3300031699|Ga0315535_1163725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 795 | Open in IMG/M |
| 3300032061|Ga0315540_10438891 | Not Available | 518 | Open in IMG/M |
| 3300032133|Ga0316583_10010586 | All Organisms → cellular organisms → Bacteria | 3326 | Open in IMG/M |
| 3300032133|Ga0316583_10025103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2129 | Open in IMG/M |
| 3300032133|Ga0316583_10038620 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300032133|Ga0316583_10043708 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300032133|Ga0316583_10065915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 1267 | Open in IMG/M |
| 3300032133|Ga0316583_10161627 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula islandica | 779 | Open in IMG/M |
| 3300032137|Ga0316585_10299058 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300032168|Ga0316593_10006038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3245 | Open in IMG/M |
| 3300032168|Ga0316593_10138186 | Not Available | 882 | Open in IMG/M |
| 3300032251|Ga0316198_10147716 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300032252|Ga0316196_10128464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1164 | Open in IMG/M |
| 3300032258|Ga0316191_11355802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium PC51MH44 | 514 | Open in IMG/M |
| 3300032259|Ga0316190_10120768 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 1833 | Open in IMG/M |
| 3300032259|Ga0316190_10389734 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300032260|Ga0316192_10217207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 1326 | Open in IMG/M |
| 3300032263|Ga0316195_10183954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1096 | Open in IMG/M |
| 3300032263|Ga0316195_10238843 | Not Available | 955 | Open in IMG/M |
| 3300033429|Ga0316193_10900167 | All Organisms → cellular organisms → Bacteria → Thermodesulfobacteria → Syntrophia → Syntrophales | 704 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 34.46% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 10.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.43% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 4.73% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 4.73% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 3.38% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.38% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 3.38% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 2.70% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.70% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 2.70% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 2.70% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.03% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.35% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 1.35% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.35% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.35% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.35% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.35% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.68% |
| Mangrove Soil | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Mangrove Soil | 0.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.68% |
| Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment | 0.68% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.68% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.68% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.68% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001371 | Baker-B-sed | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002495 | 454 Fosmid Sequence | Environmental | Open in IMG/M |
| 3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
| 3300003989 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004001 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 | Environmental | Open in IMG/M |
| 3300004004 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 | Environmental | Open in IMG/M |
| 3300004014 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004018 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D2 | Environmental | Open in IMG/M |
| 3300004026 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 | Environmental | Open in IMG/M |
| 3300004028 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 | Environmental | Open in IMG/M |
| 3300004030 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 | Environmental | Open in IMG/M |
| 3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004074 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004075 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004077 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004147 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 | Environmental | Open in IMG/M |
| 3300004330 | Marine microbial communities from Galveston Bay (CSEDA13C- fraction 6) | Environmental | Open in IMG/M |
| 3300005215 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300005917 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKH | Environmental | Open in IMG/M |
| 3300005919 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKM | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300007896 | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_3 | Environmental | Open in IMG/M |
| 3300009033 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG | Environmental | Open in IMG/M |
| 3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
| 3300009060 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MG | Environmental | Open in IMG/M |
| 3300009061 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_B_D2_MG | Environmental | Open in IMG/M |
| 3300009127 | Combined Assembly of Gp0137036, Gp0137038 | Environmental | Open in IMG/M |
| 3300009145 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG | Environmental | Open in IMG/M |
| 3300009314 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300009788 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300019700 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_2-3_MG | Environmental | Open in IMG/M |
| 3300019708 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MG | Environmental | Open in IMG/M |
| 3300019727 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_3-4_MG | Environmental | Open in IMG/M |
| 3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022307 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022860 | Saline water microbial communities from Ace Lake, Antarctica - #1450 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025557 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025564 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025565 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025583 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025599 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025649 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKM (SPAdes) | Environmental | Open in IMG/M |
| 3300025799 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025801 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025802 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025813 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025814 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025817 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025969 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025970 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025977 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025983 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025984 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026352 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300029827 | Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047 | Environmental | Open in IMG/M |
| 3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
| 3300031277 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-30 | Environmental | Open in IMG/M |
| 3300031371 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-10 | Environmental | Open in IMG/M |
| 3300031552 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-20 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Host-Associated | Open in IMG/M |
| 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Host-Associated | Open in IMG/M |
| 3300031699 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Host-Associated | Open in IMG/M |
| 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Host-Associated | Open in IMG/M |
| 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBDRAFT_103448611 | 3300001371 | Marine Estuarine | MASDAVGAVKLEIPEGFKFLKFRMSEYLKNIIKLTISKI* |
| BBDRAFT_104128142 | 3300001371 | Marine Estuarine | DAVDAVKLEIPQGFKLLKFKMSEYLKNIVKLTISKI* |
| KVRMV2_1001639132 | 3300002231 | Marine Sediment | MSFRYPPEDFGGCGAASDAVDAVKLEIPSGFKILKFKMSEYLKNIVKLTITKI* |
| BRMGV_10256551 | 3300002495 | Mangrove Soil | AIFKFAVDTRKMLFRYAAYAAASDAVDAVKLEILKGFKLLKSKMTEYLKNIIKLNILKI* |
| Ga0055475_100531582 | 3300003988 | Natural And Restored Wetlands | MASDAVDAVKLEIPQGFKLLRFKMSKYLKNSIKLTISKI* |
| Ga0055475_100624253 | 3300003988 | Natural And Restored Wetlands | LCGTASDAVDVVKLEIPQGLKLLKFKMSEYLKDIVKLTISKI* |
| Ga0055475_102554772 | 3300003988 | Natural And Restored Wetlands | LCGTASDAVDVVKLEIPQGFKLLQFKMSEYLKNIVKLTISKI* |
| Ga0055473_102012812 | 3300003989 | Natural And Restored Wetlands | YSRLCGTASDAVDVVKLEIPQGLKLLKFKMSEYLKDIVKLTISKI* |
| Ga0055455_102377702 | 3300003990 | Natural And Restored Wetlands | MRNPALRGKMFFRYSRLCGTVSDTVGTVKLEIPKGFKLLKFKMSEY |
| Ga0055450_100106263 | 3300004001 | Natural And Restored Wetlands | MASDAVDAVKLEIPQGFKLLRFKMSKYLKNIIKLTISKI* |
| Ga0055451_102001871 | 3300004004 | Natural And Restored Wetlands | NSRLCGTASDAVDAVKLEILQGYKLLKLKMQEFLKNLLN* |
| Ga0055456_103156301 | 3300004014 | Natural And Restored Wetlands | GTASDAVDAVKLEIPKGFKLLKFKMSEYLKNMFKLTISKI* |
| Ga0055456_103412151 | 3300004014 | Natural And Restored Wetlands | YSRLCGTASDTVDAVKLEIPTCPVVLKKRSRKGFKLLKFKTTEYLKNTVKLTISKI* |
| Ga0055452_100607272 | 3300004018 | Natural And Restored Wetlands | VLFRYSHLCGTASDAIDAVKLESPQGFKLLKFKITEYLKNIVIVTISKI* |
| Ga0055452_102090742 | 3300004018 | Natural And Restored Wetlands | LCGTASDAVDAVKLEIPQGFKLLQFKMSECLKNIIKLTISKI* |
| Ga0055452_103442161 | 3300004018 | Natural And Restored Wetlands | TASDEVGAVKLVIPKGFKFLKYRMAKYIESIIKLTISII* |
| Ga0055443_100301113 | 3300004026 | Natural And Restored Wetlands | YSRLCGTASDAVDGGEIGNPVGFQFLKFRMSEYLKNIVKSTILKI* |
| Ga0055447_102603281 | 3300004028 | Natural And Restored Wetlands | MPFRYSRLCGTASDAVDAVNLEIPKGFKFLKFKMSEYLKNIVFLTISKI* |
| Ga0055444_100185821 | 3300004030 | Natural And Restored Wetlands | GTASDTVDAVKLEIPKGFKFLKFKMPECLKHKIKFTISKI* |
| Ga0055492_101586602 | 3300004051 | Natural And Restored Wetlands | GTASDAVDAVKLEIAGFQIAEIQNEEYLKNIVELTISKI* |
| Ga0055518_101977951 | 3300004074 | Natural And Restored Wetlands | MSFRYSRLCETASDAVDVVKLQIPQGFKFLKFRMPEYLKNMIQLTILKI* |
| Ga0055519_100725402 | 3300004075 | Natural And Restored Wetlands | MLFRYSRLCGTASDAVDAVKWEIPQGFKLLKFKMSEYLKNIVNLTISKI* |
| Ga0055523_100801261 | 3300004077 | Natural And Restored Wetlands | MLFRYSRLCGTSSDAVDAVKLKIPQGLKLLKFKMSGYLRNIVKLTISKI* |
| Ga0055523_101517051 | 3300004077 | Natural And Restored Wetlands | YSHLCGTASDAIDAVKLESPQGFKLLKFKITEYLKNIIIVTISKI* |
| Ga0055495_100629852 | 3300004146 | Natural And Restored Wetlands | GTASDAVDAVKLEIPKGFKFLKFKMSEYPKNIFNLSISKI* |
| Ga0055515_100209401 | 3300004147 | Natural And Restored Wetlands | TDTRKIPFRYSRLCGTESDAVDAVKLEIPKGSKLLEFNISDYLKNIVKLSISKI* |
| Ga0065200_12137443 | 3300004330 | Sediment | MLFRYSRLCGTASDAVDAVKLEILKGFKLLKLKLTEYLKNIIKLTISKI* |
| Ga0069001_100104053 | 3300005215 | Natural And Restored Wetlands | FKFATDTRKIPFRYNRLCGRESDAVDAVKLKIPKGSKLLEFKISDYLKNIVKLTISKI* |
| Ga0069001_101112191 | 3300005215 | Natural And Restored Wetlands | YSRLCGTASDAVDAEIGNPVGFQFLKFRMSEYLKNIVKSTILKI* |
| Ga0069001_102205101 | 3300005215 | Natural And Restored Wetlands | KMSFRYSRLCETASDAVNAVKLQIPQGFKFLKFRMPEYLKNMIQLTILKI* |
| Ga0070727_100385373 | 3300005590 | Marine Sediment | MASDAVDAVKLKIPKGFKFLKFKMSERLKNIIKLTILKI* |
| Ga0070726_100342661 | 3300005600 | Marine Sediment | VDAVKLEIPQGFKLLKFKMSEYLKNIVDLTISGVGEFF* |
| Ga0070722_100534751 | 3300005601 | Marine Sediment | MLFRYSRLCGTAVDAVGAVKLEIPKGFKFLKFRMAEYLKNIIKLTIS* |
| Ga0074469_100515262 | 3300005832 | Sediment (Intertidal) | MLVRYSCLCGTASDAVNAVKLEIPQGFKLLKFKMADYIKNIV* |
| Ga0074469_103867962 | 3300005832 | Sediment (Intertidal) | MLFRYSCLCGTASDAVDVVKLEIPQGFKLLKFKMSEYLKNIVNLTISKI* |
| Ga0075115_101179901 | 3300005917 | Saline Lake | AADTRKMLFRYSRLCGTASDAVDAVILLRRIKIGNPAGFKLLKFKMSEYLKNIVKLIISKI* |
| Ga0075115_102523712 | 3300005917 | Saline Lake | GTASDAVDAVKLEIPQGFKLLKFKMPECLKNIVKLTSSKI* |
| Ga0075114_100224751 | 3300005919 | Saline Lake | KFAADTRKMLFRYSRLCGTASDAVDAVILLRRIKIGNPAGFKLLKFKMSEYLKNIVKLIISKI* |
| Ga0070725_101019052 | 3300005920 | Marine Sediment | AAREKMLFRYSRLCGTASDAVDAVILLRRKKLEIPQGFKLLKFKMSEYLKISLN* |
| Ga0070725_105722181 | 3300005920 | Marine Sediment | DAVDAVKLEIPQGFKLLKFKMSEYLKNIVELTISKI* |
| Ga0111484_11152631 | 3300007896 | Sediment | RLCGTASDAVDAVKLEIPQGFKLLKFKMSEYLKYIVKLTISKI* |
| Ga0102956_11304822 | 3300009033 | Soil | MLFRYSRLCGTASDAVDVVKLEIPQGLKLLKFKMSEYLKDIVKLTISKI* |
| Ga0102956_11534731 | 3300009033 | Soil | TASAKVDAVKWEIPQDFKLLKLKMPEYLKNIVKVTISKI* |
| Ga0102956_11977842 | 3300009033 | Soil | RLCGTASDAVDAVKLEIPKGFKLLKFKTSEYLKNIIK* |
| Ga0102956_12333021 | 3300009033 | Soil | MLFRYSRLCGTASDAVRRSRLRGDAVKSEIPQGFKLLKLKMSEYIKNIVELTILKI* |
| Ga0102956_13070202 | 3300009033 | Soil | CGTASDTVAAVKLEIPQGFNLLKFKMSEYLRNIVKLTISKI* |
| Ga0102958_11164902 | 3300009035 | Soil | RYSLLCGTASDAVDAVKLEIPQGFELLKFKMSEYFKNIVKLTISKI* |
| Ga0102958_13471932 | 3300009035 | Soil | LCGTASDTIEAVKLEIPQGFKLLKFKMSKYLKNIFKLNISKI* |
| Ga0102962_10221221 | 3300009060 | Soil | CGTASDAVDAVKLEIPQGFELLKFKMSEYLKNIVKLTISKI* |
| Ga0102962_10389963 | 3300009060 | Soil | DAVDAVKLEIPQGFKLLKFKMSEYLKNFVKVTILKI* |
| Ga0102938_101669021 | 3300009061 | Pond Soil | LCGTSSDAVDAVKLEIPKGFKFLKPKMINTFKIIEK* |
| Ga0118724_11362162 | 3300009127 | Marine | MASDAVDAVKLEIPSGFKFFKFKLTQFLKNILKLTISKI* |
| Ga0118724_11380122 | 3300009127 | Marine | MLFRYSCLCGAASDEVDAVKLEIPLGFKLLKFKMSEYLKNIGKITILKI* |
| Ga0102961_10435971 | 3300009145 | Soil | MLFRYNRLCGTASNTVDAVKLEIPQGFKLLKFKMSEYLKNIVKLTISK |
| Ga0102961_11307491 | 3300009145 | Soil | SRLCGTASDTVDAVKLEIPQGFKLLKFKMSKHLKNIVKLNISKI* |
| Ga0117908_10100621 | 3300009314 | Marine | MLFRYSCLWGAASDEVDAVKLEIPLGFKLLKFKMSEYLKNIGKITILKI* |
| Ga0117908_101006212 | 3300009314 | Marine | MRSGTDEVDAVKLEIPLGFKLLKFKMSEYLKNIGKITILKI* |
| Ga0117908_101382112 | 3300009314 | Marine | MLFRYSCLCGAASDEVDAVKLEIPLGFKLLKFKMAKYLKNIGKITILKI* |
| Ga0118657_1000195424 | 3300009506 | Mangrove Sediment | MLFRYSRLCGTASDTVDEVKLEIPQGFKILKFKMSEYLKIIVKETISKI* |
| Ga0118657_102787216 | 3300009506 | Mangrove Sediment | MSFRYSRLCGTASDTVDAVKLKIPKGFKILKFKMSEYPKNIIKLAIL* |
| Ga0118657_103025031 | 3300009506 | Mangrove Sediment | SRLCGTTSAAVDAVKSEIPQGFKLLKFKMSEYVKNIVELTVSKI* |
| Ga0118657_103517592 | 3300009506 | Mangrove Sediment | MASDAVDAVKLEIPQGFKLLKFKRSEYLKNILKLIISKI* |
| Ga0118657_126417071 | 3300009506 | Mangrove Sediment | RLYGTAPDAVDAVKLEIPKGFKFLKCRMVKYLKNIIKLTISKI* |
| Ga0123573_107809921 | 3300009509 | Mangrove Sediment | CGTASDAVDAVKLEIPQGLKLLKFKMSEYLKNIVKLNIS* |
| Ga0114923_102164863 | 3300009788 | Deep Subsurface | DAVDAVKLEIPEGFKFLKFKSTEFLKKSLKLTILKI* |
| Ga0118731_1077848301 | 3300010392 | Marine | SDAVDAVKLEIPQGFKLLKFKMSEYLKNIVKLTISKI* |
| Ga0136852_114685911 | 3300010412 | Mangrove Sediment | MSFRYPPEGFGGCGTASDAVDAVKFEIPKGFKLLKFKMSKYLKNIVKLTSSKI* |
| Ga0136851_1000983811 | 3300010413 | Mangrove Sediment | MLFRYSRLCGTASEAVDAVNLEIPQGFKLLKFKMSEYLKNIVTLTISKI* |
| Ga0136851_106280812 | 3300010413 | Mangrove Sediment | VDAVKLEILKGFKLLKFKMSKYLKNIVKLTSSKI* |
| Ga0136851_107483632 | 3300010413 | Mangrove Sediment | SDAVDAVKLEIPKGLKLLEFKIPEYLKNIFKLTISIT* |
| Ga0136851_110721151 | 3300010413 | Mangrove Sediment | SRLCGTASDAVDAMKLEIRYGFKLLKFKKAEYLKNIVNLTIS* |
| Ga0136851_113684222 | 3300010413 | Mangrove Sediment | VDAVKSEIPQGFKLLKFKMSEYLKNIVELTVSKI* |
| Ga0118733_1025840412 | 3300010430 | Marine Sediment | MKTFQSGICGTASDPVDAVKLKIPKGFKYLKLKMSECFKNIVKLTISKI* |
| Ga0075349_11117722 | 3300014305 | Natural And Restored Wetlands | ASDAVDAVKLEIPKGFKFLKFKMSEYLKNIVNLTISKI* |
| Ga0194006_10490652 | 3300019700 | Sediment | MASDTVDAVKLGIPQGFKLLKFKMSEYLKNIVKLTISKI |
| Ga0194016_10400191 | 3300019708 | Sediment | MLFRYSRLCGTASGAVDAVKLEILKGFKLLKFKMSEYLKNIVKLTISKI |
| Ga0193976_10334881 | 3300019727 | Sediment | MLFRYSRLCGTASDAVDAVKWEIPQGFKLLKFKMSECLKNIVKLTI |
| Ga0224514_101098802 | 3300022217 | Sediment | MLLRYSRLCGTASDAVDAVKLGIPQGFKLLKFKMSEYLKNIVKLTIS |
| Ga0224502_102375881 | 3300022218 | Sediment | SDAVGAVKLGIPQGFKLLKFKMSEYLKNIVKLTISKILNAQLGS |
| Ga0224513_100143693 | 3300022220 | Sediment | MLLRYSRLCGKASDAVDAVKLGIPQGFKLLKFKMSEYLKNIVKLTISKIL |
| Ga0224507_102350071 | 3300022307 | Sediment | SRLCGTASDAVGAVKLGIPQGFKLLKFKMSEYLKNIVKLTISKILNAQLGS |
| Ga0222698_10219504 | 3300022860 | Saline Water | AVDAVKLEIPQGFKLLKFKMPECLKNIVKLTSSKI |
| Ga0222698_10356112 | 3300022860 | Saline Water | MLFRYSRLCGTASDAVDAVILLRRIKIGNPAGFKLLKFKMSEYLKNIVKLIISKI |
| (restricted) Ga0255045_100802662 | 3300024528 | Seawater | MLFRYSRLCGTASDAVDAVKLEILQGFKLLKFKMSEYLKNIVKLTISKI |
| Ga0210120_10261993 | 3300025556 | Natural And Restored Wetlands | KMLFRYSYLCGKTSDAVDAAKLEIPEGFKLLKFRMAEYLKNIIELTISKI |
| Ga0210141_10380111 | 3300025557 | Natural And Restored Wetlands | MLFRYSRLCGTASDAVRRSRLRGDAVKSEIPQGFKLLKLKMSEYIKNIVELTILKI |
| Ga0210141_10440793 | 3300025557 | Natural And Restored Wetlands | LFRYSRLCGTASDTVGAVKLEIPQGFKLLKFKMSEYLRNTFN |
| Ga0210084_10004113 | 3300025564 | Natural And Restored Wetlands | MLFRYSRLCGTASDAVDAVKSEIPQGFKLLKFKMSEYLKNMVKLTISEI |
| Ga0210084_10072071 | 3300025564 | Natural And Restored Wetlands | MLFRYSRLCGTASDAVDAVKLEVLQDFKLLQFKMLEYLKNIVKLTISKI |
| Ga0210110_10836311 | 3300025565 | Natural And Restored Wetlands | MSFRYSRQCGTASDAVDAVKWEIPQGFKLLKFKIAEYLKNIFKLTISKILNAQLRFKFNN |
| Ga0210085_10000199 | 3300025583 | Natural And Restored Wetlands | MASDAVDAVKLEIPQGFKLLRFKMSKYLKNIIKLTISKI |
| Ga0210085_11371491 | 3300025583 | Natural And Restored Wetlands | LCGTASDAVDAVKLEIPQGFKLLKFKMAEYLKKFFKLTLSKI |
| Ga0210074_10484773 | 3300025599 | Natural And Restored Wetlands | ALRGKMSFRYCRLCETASDAVDAVKLEIQQGFKFLKFRMSECLKNMIK |
| Ga0208279_10128551 | 3300025649 | Saline Lake | RYSRLCGTASDAVDAVILLRRIKIGNPAGFKLLKFKMSEYLKNIVKLIISKI |
| Ga0210122_10101204 | 3300025799 | Natural And Restored Wetlands | MLFRYSRLCGTASNTVDAVKLEIPQGFKLLKFKMSEYLKNIVKLTISK |
| Ga0210122_10740302 | 3300025799 | Natural And Restored Wetlands | CGTASDAIDAVKLESPQGFKLLKFKITEYLKNIIIVTISKI |
| Ga0210122_11005691 | 3300025799 | Natural And Restored Wetlands | SDAVDAVKLEIPQGFKLLQFKMSECLKNIVKLTISKI |
| Ga0210097_11802671 | 3300025801 | Natural And Restored Wetlands | MLFRYIRLCGTASDGVDAVKLEIPQGFKLLKFKMSEYLKNIVKLTISII |
| Ga0210111_10161782 | 3300025802 | Natural And Restored Wetlands | KVLFRYSHLCGTASDAIDAVKLESPQGFKLLKFKITEYLKNIVIVTISKI |
| Ga0210064_11416121 | 3300025813 | Natural And Restored Wetlands | HLCGTASDAVDVVKLEIPQGFKLLQFKMSEYLKNIVKLTISKI |
| Ga0210101_10593911 | 3300025814 | Natural And Restored Wetlands | YSRLCETASDAVDAVKLEIQQGFKFLKFRMSECLKNMIK |
| Ga0210144_10033924 | 3300025817 | Natural And Restored Wetlands | MLFRYSRLCGKASDAVDGVKLEIPQGFKLLKFKMAEYLKDIVKLTISKI |
| Ga0210080_10168112 | 3300025969 | Natural And Restored Wetlands | SCLCGTASDAVDAVKSEIPQGFKLLKFKMSEYLKNIVKLTISKI |
| Ga0210081_10713541 | 3300025970 | Natural And Restored Wetlands | RLCGTASDAVGAVKLEIPKGFRLLKFKMSECLKNIIKLTISKI |
| Ga0210072_10025551 | 3300025977 | Natural And Restored Wetlands | YSRLCGTASDAVNAVKLEIPKGFKLLKFKMSECLKNIVKLPISKI |
| Ga0210106_10226432 | 3300025983 | Natural And Restored Wetlands | SRLCGKASDTVDAVKLEIPKGFKLLKFKMSEYLKLILKLTISKI |
| Ga0210106_10242401 | 3300025983 | Natural And Restored Wetlands | ASDAVDAVKLEIPKGFKLLKFKMSEYLKNIVKLTISKI |
| Ga0210106_10380662 | 3300025983 | Natural And Restored Wetlands | ASDAVDAVKLEIPKGFKLLKFKMSEYLKNIVKLPISKI |
| Ga0210082_10013232 | 3300025984 | Natural And Restored Wetlands | MSFRYIRLWETASDAVDVVKLQIPQGFKFLKFRMPEYLKNMIQLTILKI |
| Ga0210082_10109291 | 3300025984 | Natural And Restored Wetlands | LCGTASDAVDAVKSEIPQGFKLLKLKMSEYIKNIVELTISKI |
| Ga0210107_10340771 | 3300026352 | Natural And Restored Wetlands | YSHLCGTASDAIDAVKLESPQGFKLLKFKITEYLKNIIIVTISKI |
| Ga0209536_1002043762 | 3300027917 | Marine Sediment | MLFRYSRLCGTAPYAVDAVKLEIPKSFKYLKLRMAQYLKKIIKLTISKI |
| Ga0209536_1003263173 | 3300027917 | Marine Sediment | MLFRYSRLCGTASDAVDAVTLEIPQGFKFLKFKMPEYLKNIAKLTISKI |
| Ga0134606_100351702 | 3300029827 | Marine Sediment | RLCGTASDAVDAVKLEIPRGFKLLKFEMSEYLNNFVAITISKI |
| Ga0315556_11594582 | 3300031256 | Salt Marsh Sediment | MASDAVDAVKLEIPKGFKSLKFKMSKYLKNNVKSTISKI |
| Ga0307425_10636772 | 3300031277 | Salt Marsh | MASDAVDAVKLKIPQGFKLLKFKMSEYLKNIVKLTISKI |
| Ga0307425_11259211 | 3300031277 | Salt Marsh | TASDAVDAVKLEIPQGFKFLKFRITEYLKNIIKITISKI |
| Ga0307423_10044099 | 3300031371 | Salt Marsh | MLFRYSYLCGTTSDAVDAVKLEIPEGFKLLKFRMAEYLKNIIELTISKI |
| Ga0307423_11146121 | 3300031371 | Salt Marsh | MLFRYSYLCGKTSDAVDAVKLEIPEGFKLLKFRMAEYLKNIIELTIS |
| Ga0315542_10139481 | 3300031552 | Salt Marsh Sediment | TASDAVDAVKLEIPQGFKLLKFKMLEYLKNIVKLTSSKI |
| Ga0307376_102769312 | 3300031578 | Soil | RYSRLCGTASDAVDAVKLEIPLGFKLLKFKTSEYLKNIVKLTISII |
| Ga0316575_100023582 | 3300031665 | Rhizosphere | MSFRYSRLCGTASDAADAVKLEIPQGFKLLKFEMPEYLNNFVKITISKI |
| Ga0316575_100086951 | 3300031665 | Rhizosphere | SDTVDVVKLKIPLGFKLLKFKMIEYLKNIAKLTISKI |
| Ga0316575_100774403 | 3300031665 | Rhizosphere | RLCGTASDAVDAVKLEIPQGFKLLKFEMSEYLNNFVKSTISKI |
| Ga0316575_101304061 | 3300031665 | Rhizosphere | MSFRYSRLCGTVSDAVDAVKLEIPQGFKLLKFEMSEYLNNFVKITIS |
| Ga0316579_102509231 | 3300031691 | Rhizosphere | RYSRLCGTASDAVDAVKLEIPRGFKLLKFEMSEYLNNFVAITISKI |
| Ga0316579_102994462 | 3300031691 | Rhizosphere | MLFRYSRLCGTASDAVDAVKLEILKGFKLLKLKLTEYLKNIIKLTISKI |
| Ga0316579_103425031 | 3300031691 | Rhizosphere | RSFRYSRLCGTASDAADAVKLEIPQGFKLLKFEMPEYLNNFVKITISKI |
| Ga0315535_11637252 | 3300031699 | Salt Marsh Sediment | RLCGMASDAVDAVKLEIPKGFKSLKFKMSKYLKNNVKSTISKI |
| Ga0315540_104388911 | 3300032061 | Salt Marsh Sediment | MSFRYSRLCGTASDKADAVKLEIPLGFKLLKFKMLEYLKDIFKLAISKI |
| Ga0316583_100105861 | 3300032133 | Rhizosphere | SDAVDAVKLEIPQGFKLLKFEMSEYLNNFVKITISKI |
| Ga0316583_100251031 | 3300032133 | Rhizosphere | RLCGTTSDTVDVVKLEIPKGFKLLKFKMLEYLKNIFKLTISKI |
| Ga0316583_100386203 | 3300032133 | Rhizosphere | DTVDVVKLKIPLGFKLLKFKMIEYLKNIVKLTISKI |
| Ga0316583_100437081 | 3300032133 | Rhizosphere | SRLCGTASDAVDAVKLEIPQGFKLLKFEMSEYLNNFVKSTISKI |
| Ga0316583_100659153 | 3300032133 | Rhizosphere | CGTASDAVDAVKLEIPQGFKLLKFEMSEYLNNYVKITISKI |
| Ga0316583_101616272 | 3300032133 | Rhizosphere | DAVDAVKLEIPQGFKLLKFEMSEYLNNFVKITISKI |
| Ga0316585_102990581 | 3300032137 | Rhizosphere | IRKMLFHYSRLCETASDTVDTVKLGIPQGFKFLKFKMSEYLKNVASHGLTPVALKI |
| Ga0316593_100060382 | 3300032168 | Rhizosphere | MLFRYSRLCGTASDAIDAVKLEILKGFKLLKFKMTEYLKNIIKLTISKI |
| Ga0316593_101381861 | 3300032168 | Rhizosphere | MLFRYSRLCGTTSDAVDAVKLEIPKGFKLLKFKMSGYLKNIIKLTILKI |
| Ga0316198_101477161 | 3300032251 | Sediment | CGTASDAVDAVKLEIPKGFKLLTFKISECLKNMVKSPTSKI |
| Ga0316196_101284642 | 3300032252 | Sediment | DAIDAVKLEIPKGFEFLKFKMSEYLKKIVNLTISKI |
| Ga0316191_113558021 | 3300032258 | Worm Burrow | LCGTASDAVGAVKLGIPQGFKLLKFKMSEYLKNIVKLTISKILNAQLGS |
| Ga0316190_101207681 | 3300032259 | Worm Burrow | MLFRYSRLCGTASDTVDAVKLGIPQGFKLLKFKMSEYLKNIVKVTLSK |
| Ga0316190_103897342 | 3300032259 | Worm Burrow | FAADPRKMLFRYSRLCGTASDAVRRFRLRGDAVKLEIPQGFKLLKYKMSEYLKNIVKLTISKI |
| Ga0316192_102172073 | 3300032260 | Worm Burrow | YSRLCGTASDAVDAVKLEIPKGSKLLKFKISEYLKNIVKLTIPKI |
| Ga0316195_101839542 | 3300032263 | Sediment | RYSELCVTASGTVDAVKLEIPEGFNFLKFKMSEYLMNIIEVTISKN |
| Ga0316195_102388431 | 3300032263 | Sediment | MLFRYRHLYVTASDAVDAVKLEIPQGFKLLKFKMTEYLKNIV |
| Ga0316193_109001671 | 3300033429 | Sediment | MLFRYSRLCGTASDAVDAVKLEIPKGSKLLKFKISEYLKNIVKLTIPKI |
| ⦗Top⦘ |