| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004330 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111382 | Gp0110220 | Ga0065200 |
| Sample Name | Marine microbial communities from Galveston Bay (CSEDA13C- fraction 6) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Shell Corporation |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 31420221 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1 |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine benthic feature → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Galveston Bay, USA | |||||||
| Coordinates | Lat. (o) | 29.5 | Long. (o) | -94.76 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025653 | Metagenome / Metatranscriptome | 200 | Y |
| F034976 | Metagenome | 173 | Y |
| F043801 | Metagenome / Metatranscriptome | 155 | Y |
| F048676 | Metagenome / Metatranscriptome | 148 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0065200_1204430 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 500 | Open in IMG/M |
| Ga0065200_1210572 | Not Available | 816 | Open in IMG/M |
| Ga0065200_1211244 | Not Available | 886 | Open in IMG/M |
| Ga0065200_1213744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1367 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0065200_1204430 | Ga0065200_12044302 | F034976 | MTGSNLVRCQRCGEPVGYITVLGRGLMGMQQPIDNVKVVAVCMDCSQKH* |
| Ga0065200_1210572 | Ga0065200_12105722 | F043801 | MFLAEKFTGICPCGFSFTTPAGKDDAVAVMKYHAELQHKKDYPNGATTEQAMKYIKKV* |
| Ga0065200_1211244 | Ga0065200_12112441 | F025653 | MSDPIEYFRHKLKDMSLRELHAYKKRLDENIKQMISTNKPNEQIAPLILYRGILEHEIKTRKTP* |
| Ga0065200_1213744 | Ga0065200_12137443 | F048676 | MLFRYSRLCGTASDAVDAVKLEILKGFKLLKLKLTEYLKNIIKLTISKI* |
| ⦗Top⦘ |