NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004330

3300004330: Marine microbial communities from Galveston Bay (CSEDA13C- fraction 6)



Overview

Basic Information
IMG/M Taxon OID3300004330 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111382 | Gp0110220 | Ga0065200
Sample NameMarine microbial communities from Galveston Bay (CSEDA13C- fraction 6)
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size31420221
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSubsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine benthic featuresediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationGalveston Bay, USA
CoordinatesLat. (o)29.5Long. (o)-94.76Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025653Metagenome / Metatranscriptome200Y
F034976Metagenome173Y
F043801Metagenome / Metatranscriptome155Y
F048676Metagenome / Metatranscriptome148Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0065200_1204430All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon500Open in IMG/M
Ga0065200_1210572Not Available816Open in IMG/M
Ga0065200_1211244Not Available886Open in IMG/M
Ga0065200_1213744All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1367Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0065200_1204430Ga0065200_12044302F034976MTGSNLVRCQRCGEPVGYITVLGRGLMGMQQPIDNVKVVAVCMDCSQKH*
Ga0065200_1210572Ga0065200_12105722F043801MFLAEKFTGICPCGFSFTTPAGKDDAVAVMKYHAELQHKKDYPNGATTEQAMKYIKKV*
Ga0065200_1211244Ga0065200_12112441F025653MSDPIEYFRHKLKDMSLRELHAYKKRLDENIKQMISTNKPNEQIAPLILYRGILEHEIKTRKTP*
Ga0065200_1213744Ga0065200_12137443F048676MLFRYSRLCGTASDAVDAVKLEILKGFKLLKLKLTEYLKNIIKLTISKI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.