Basic Information | |
---|---|
Family ID | F044511 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 154 |
Average Sequence Length | 46 residues |
Representative Sequence | TKRAPDAGDSAAISSSFLRLSIFPVGRRSAARPSAGNANR |
Number of Associated Samples | 83 |
Number of Associated Scaffolds | 154 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 21.28 % |
% of genes near scaffold ends (potentially truncated) | 81.17 % |
% of genes from short scaffolds (< 2000 bps) | 70.78 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.416 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge (12.987 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.013 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (45.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.88% β-sheet: 0.00% Coil/Unstructured: 69.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 154 Family Scaffolds |
---|---|---|
PF00583 | Acetyltransf_1 | 1.95 |
PF00795 | CN_hydrolase | 1.30 |
PF00293 | NUDIX | 1.30 |
PF05117 | DUF695 | 1.30 |
PF13250 | DUF4041 | 1.30 |
PF13460 | NAD_binding_10 | 1.30 |
PF13649 | Methyltransf_25 | 1.30 |
PF00300 | His_Phos_1 | 1.30 |
PF07719 | TPR_2 | 0.65 |
PF10881 | DUF2726 | 0.65 |
PF13751 | DDE_Tnp_1_6 | 0.65 |
PF02517 | Rce1-like | 0.65 |
PF13181 | TPR_8 | 0.65 |
PF02452 | PemK_toxin | 0.65 |
PF01939 | NucS | 0.65 |
PF13546 | DDE_5 | 0.65 |
PF14281 | PDDEXK_4 | 0.65 |
PF03243 | MerB | 0.65 |
PF13289 | SIR2_2 | 0.65 |
PF02730 | AFOR_N | 0.65 |
PF01844 | HNH | 0.65 |
PF11848 | DUF3368 | 0.65 |
PF05099 | TerB | 0.65 |
PF02574 | S-methyl_trans | 0.65 |
PF03193 | RsgA_GTPase | 0.65 |
PF12893 | Lumazine_bd_2 | 0.65 |
PF13238 | AAA_18 | 0.65 |
PF00575 | S1 | 0.65 |
PF14088 | DUF4268 | 0.65 |
PF00782 | DSPc | 0.65 |
PF01370 | Epimerase | 0.65 |
PF07366 | SnoaL | 0.65 |
PF02653 | BPD_transp_2 | 0.65 |
PF00145 | DNA_methylase | 0.65 |
PF00398 | RrnaAD | 0.65 |
PF01555 | N6_N4_Mtase | 0.65 |
PF00196 | GerE | 0.65 |
PF13783 | DUF4177 | 0.65 |
PF13651 | EcoRI_methylase | 0.65 |
PF07635 | PSCyt1 | 0.65 |
PF00122 | E1-E2_ATPase | 0.65 |
PF08445 | FR47 | 0.65 |
PF13412 | HTH_24 | 0.65 |
PF04471 | Mrr_cat | 0.65 |
PF13020 | NOV_C | 0.65 |
PF12910 | PHD_like | 0.65 |
PF13551 | HTH_29 | 0.65 |
PF13207 | AAA_17 | 0.65 |
PF11528 | DUF3224 | 0.65 |
PF02037 | SAP | 0.65 |
PF13643 | DUF4145 | 0.65 |
PF13588 | HSDR_N_2 | 0.65 |
PF02086 | MethyltransfD12 | 0.65 |
PF12746 | GNAT_acetyltran | 0.65 |
PF13189 | Cytidylate_kin2 | 0.65 |
PF14279 | HNH_5 | 0.65 |
PF03235 | DUF262 | 0.65 |
PF11599 | AviRa | 0.65 |
COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
---|---|---|---|
COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 0.65 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.65 |
COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.65 |
COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.65 |
COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 0.65 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.65 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.65 |
COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.65 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.65 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.65 |
COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.65 |
COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.65 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 0.65 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.65 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.65 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.65 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.65 |
COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.65 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.06 % |
Unclassified | root | N/A | 14.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000228|TB_PC08_66DRAFT_10064035 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. CLA17 | 1273 | Open in IMG/M |
3300000233|TB_FS06_10DRAFT_1011286 | All Organisms → cellular organisms → Bacteria | 3368 | Open in IMG/M |
3300000235|TB_PC08_3DRAFT_1048576 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300000235|TB_PC08_3DRAFT_1049502 | Not Available | 870 | Open in IMG/M |
3300000236|TB_FS08_3DRAFT_1012274 | All Organisms → Viruses → Predicted Viral | 2008 | Open in IMG/M |
3300001580|Draft_10030532 | All Organisms → cellular organisms → Bacteria | 3808 | Open in IMG/M |
3300002024|MIS_1061308 | All Organisms → cellular organisms → Bacteria → PVC group → Kiritimatiellota → Kiritimatiellia → Kiritimatiellales → Pontiellaceae → Pontiella → Pontiella desulfatans | 1256 | Open in IMG/M |
3300002024|MIS_1147598 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1037 | Open in IMG/M |
3300002027|MIS_10043857 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 2876 | Open in IMG/M |
3300003465|P52013CM_1012731 | All Organisms → cellular organisms → Bacteria | 3599 | Open in IMG/M |
3300005077|Ga0071116_1181930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-6 | 871 | Open in IMG/M |
3300005077|Ga0071116_1191614 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 818 | Open in IMG/M |
3300005077|Ga0071116_1227687 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300005656|Ga0073902_10310032 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300005824|Ga0074474_1155919 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 757 | Open in IMG/M |
3300005827|Ga0074478_1341526 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 978 | Open in IMG/M |
3300005829|Ga0074479_10723022 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1640 | Open in IMG/M |
3300005830|Ga0074473_10784771 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300005830|Ga0074473_10916767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 614 | Open in IMG/M |
3300005903|Ga0075279_10023278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → Geobacter metallireducens | 911 | Open in IMG/M |
3300005961|Ga0075157_10275992 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 643 | Open in IMG/M |
3300005982|Ga0075156_10008939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5861 | Open in IMG/M |
3300005982|Ga0075156_10035324 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 2944 | Open in IMG/M |
3300005982|Ga0075156_10049170 | All Organisms → cellular organisms → Bacteria | 2447 | Open in IMG/M |
3300005982|Ga0075156_10069713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2004 | Open in IMG/M |
3300005982|Ga0075156_10173912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1166 | Open in IMG/M |
3300005982|Ga0075156_10216109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1022 | Open in IMG/M |
3300005982|Ga0075156_10238360 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300005982|Ga0075156_10269866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 894 | Open in IMG/M |
3300005989|Ga0075154_10514987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas hankookensis | 654 | Open in IMG/M |
3300006033|Ga0075012_10465517 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 820 | Open in IMG/M |
3300006033|Ga0075012_10942877 | Not Available | 511 | Open in IMG/M |
3300006056|Ga0075163_10402145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1528 | Open in IMG/M |
3300006056|Ga0075163_10812119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 981 | Open in IMG/M |
3300006056|Ga0075163_11118928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 795 | Open in IMG/M |
3300006056|Ga0075163_11214382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 754 | Open in IMG/M |
3300006092|Ga0082021_1194601 | All Organisms → cellular organisms → Bacteria | 3746 | Open in IMG/M |
3300007004|Ga0079218_10974807 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 845 | Open in IMG/M |
3300007072|Ga0073932_1062297 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
3300009009|Ga0105105_10046535 | Not Available | 1945 | Open in IMG/M |
3300009009|Ga0105105_10602444 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300009037|Ga0105093_10365855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 780 | Open in IMG/M |
3300009146|Ga0105091_10284458 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 804 | Open in IMG/M |
3300009146|Ga0105091_10360215 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 719 | Open in IMG/M |
3300009295|Ga0103747_10166397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Lactimicrobium → Lactimicrobium massiliense | 590 | Open in IMG/M |
3300009782|Ga0116157_10448004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 663 | Open in IMG/M |
3300011391|Ga0137331_1012410 | Not Available | 797 | Open in IMG/M |
3300011407|Ga0137450_1041076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 826 | Open in IMG/M |
3300011408|Ga0137460_1045072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 799 | Open in IMG/M |
3300012161|Ga0137336_1044853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 806 | Open in IMG/M |
3300012168|Ga0137357_1079320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 674 | Open in IMG/M |
3300012533|Ga0138256_10304525 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
3300012533|Ga0138256_10363647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Levilinea → Levilinea saccharolytica | 1209 | Open in IMG/M |
3300012533|Ga0138256_10544573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 930 | Open in IMG/M |
3300012533|Ga0138256_10637033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 840 | Open in IMG/M |
3300012533|Ga0138256_10973784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_64_43 | 641 | Open in IMG/M |
3300012533|Ga0138256_11209466 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 560 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10050320 | All Organisms → cellular organisms → Bacteria | 3323 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10057124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales | 3035 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10143340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1590 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10431265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 738 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10051256 | All Organisms → cellular organisms → Bacteria | 3557 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10113430 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10505135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 735 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10476549 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 839 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10789796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
3300013502|Ga0119901_1093157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 940 | Open in IMG/M |
3300014149|Ga0181613_1005855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5217 | Open in IMG/M |
3300014502|Ga0182021_11689942 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300018059|Ga0184615_10038295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2663 | Open in IMG/M |
3300018059|Ga0184615_10117392 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
3300018059|Ga0184615_10239355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1018 | Open in IMG/M |
3300018059|Ga0184615_10448332 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 701 | Open in IMG/M |
3300018059|Ga0184615_10651765 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 541 | Open in IMG/M |
3300021090|Ga0210377_10241314 | Not Available | 1132 | Open in IMG/M |
3300021090|Ga0210377_10499148 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 703 | Open in IMG/M |
3300021090|Ga0210377_10556373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 653 | Open in IMG/M |
3300023201|Ga0256614_1403650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1318 | Open in IMG/M |
(restricted) 3300024054|Ga0233425_10032179 | All Organisms → cellular organisms → Bacteria | 4173 | Open in IMG/M |
3300025017|Ga0210022_1024970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2443 | Open in IMG/M |
3300025826|Ga0210033_1012741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4860 | Open in IMG/M |
3300025855|Ga0209717_1309385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 558 | Open in IMG/M |
3300027739|Ga0209575_10133815 | Not Available | 896 | Open in IMG/M |
3300027776|Ga0209277_10069304 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1586 | Open in IMG/M |
3300027792|Ga0209287_10188176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 786 | Open in IMG/M |
3300027792|Ga0209287_10204477 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 753 | Open in IMG/M |
3300027887|Ga0208980_10282524 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 963 | Open in IMG/M |
3300027900|Ga0209253_11187867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
3300028283|Ga0268283_1040524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1478 | Open in IMG/M |
3300028647|Ga0272412_1012546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 3399 | Open in IMG/M |
3300028647|Ga0272412_1187073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 861 | Open in IMG/M |
3300028674|Ga0302161_10023839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1460 | Open in IMG/M |
3300028804|Ga0268298_10009187 | All Organisms → cellular organisms → Bacteria | 8470 | Open in IMG/M |
3300028804|Ga0268298_10019307 | All Organisms → cellular organisms → Bacteria | 5201 | Open in IMG/M |
3300028804|Ga0268298_10019682 | All Organisms → cellular organisms → Bacteria | 5137 | Open in IMG/M |
3300028804|Ga0268298_10021866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_54_18 | 4771 | Open in IMG/M |
3300028804|Ga0268298_10036074 | All Organisms → cellular organisms → Bacteria | 3412 | Open in IMG/M |
3300028804|Ga0268298_10040080 | All Organisms → cellular organisms → Bacteria | 3181 | Open in IMG/M |
3300028804|Ga0268298_10048128 | Not Available | 2818 | Open in IMG/M |
3300028804|Ga0268298_10048835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2791 | Open in IMG/M |
3300028804|Ga0268298_10086762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1901 | Open in IMG/M |
3300028804|Ga0268298_10154583 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1293 | Open in IMG/M |
3300028804|Ga0268298_10186377 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300028804|Ga0268298_10206546 | Not Available | 1067 | Open in IMG/M |
3300028804|Ga0268298_10219061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1026 | Open in IMG/M |
3300028804|Ga0268298_10247314 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300028804|Ga0268298_10281399 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 869 | Open in IMG/M |
3300028804|Ga0268298_10364685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 731 | Open in IMG/M |
3300028804|Ga0268298_10619634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
3300029990|Ga0311336_10859321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 783 | Open in IMG/M |
3300030000|Ga0311337_11020400 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 721 | Open in IMG/M |
3300030114|Ga0311333_10547792 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 952 | Open in IMG/M |
3300030114|Ga0311333_10598476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 912 | Open in IMG/M |
3300030114|Ga0311333_11674079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 551 | Open in IMG/M |
3300030943|Ga0311366_11233350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 644 | Open in IMG/M |
3300031232|Ga0302323_100177555 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 2135 | Open in IMG/M |
3300031521|Ga0311364_10783241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 957 | Open in IMG/M |
3300031726|Ga0302321_100345173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1606 | Open in IMG/M |
3300031902|Ga0302322_101159305 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 936 | Open in IMG/M |
3300031902|Ga0302322_103008040 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 580 | Open in IMG/M |
3300032163|Ga0315281_11673302 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 618 | Open in IMG/M |
3300032173|Ga0315268_10648017 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300032516|Ga0315273_10000104 | All Organisms → cellular organisms → Bacteria | 70391 | Open in IMG/M |
3300033407|Ga0214472_10827170 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 831 | Open in IMG/M |
3300033414|Ga0316619_10185666 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300033418|Ga0316625_100651933 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300033420|Ga0316608_1060545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1091 | Open in IMG/M |
3300033420|Ga0316608_1077148 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 934 | Open in IMG/M |
3300033446|Ga0316611_1013526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2517 | Open in IMG/M |
3300033446|Ga0316611_1026943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → Herpetosiphon → Herpetosiphon llansteffanensis | 1688 | Open in IMG/M |
3300033446|Ga0316611_1033823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1471 | Open in IMG/M |
3300033482|Ga0316627_100056750 | All Organisms → cellular organisms → Bacteria | 2426 | Open in IMG/M |
3300033482|Ga0316627_102323061 | Not Available | 563 | Open in IMG/M |
3300033488|Ga0316621_11166102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 581 | Open in IMG/M |
3300033498|Ga0316610_1050848 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300033498|Ga0316610_1061874 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 875 | Open in IMG/M |
3300033498|Ga0316610_1076697 | Not Available | 766 | Open in IMG/M |
3300033498|Ga0316610_1094407 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 672 | Open in IMG/M |
3300033521|Ga0316616_100679189 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1228 | Open in IMG/M |
3300034349|Ga0370504_0149887 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 664 | Open in IMG/M |
3300034627|Ga0316609_043688 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 813 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 12.99% |
Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 10.39% |
Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat | 9.09% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 9.09% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.79% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.55% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.90% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 3.90% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 3.25% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.25% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 3.25% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.25% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.60% |
Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 2.60% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.95% |
Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 1.95% |
Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 1.30% |
Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 1.30% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.30% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.65% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.65% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.65% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.65% |
Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | 0.65% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.65% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.65% |
Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.65% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.65% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.65% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.65% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.65% |
Wastewater Treatment Plant | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant | 0.65% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.65% |
Activated Sludge | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge | 0.65% |
Enhanced Biological Phosphorus Removal Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor | 0.65% |
Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000228 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66 | Environmental | Open in IMG/M |
3300000233 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS06_10 | Environmental | Open in IMG/M |
3300000235 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_3 | Environmental | Open in IMG/M |
3300000236 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS08_3 | Environmental | Open in IMG/M |
3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
3300002024 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1k-1.5k | Environmental | Open in IMG/M |
3300002027 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k | Environmental | Open in IMG/M |
3300003465 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample | Environmental | Open in IMG/M |
3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
3300005656 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit | Engineered | Open in IMG/M |
3300005824 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC | Environmental | Open in IMG/M |
3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
3300005961 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA | Engineered | Open in IMG/M |
3300005982 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA | Engineered | Open in IMG/M |
3300005989 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA | Engineered | Open in IMG/M |
3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
3300006092 | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore | Engineered | Open in IMG/M |
3300006417 | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 | Engineered | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007072 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009295 | Microbial communities of wastewater sludge from Singapore - Sludge5_b2_February | Environmental | Open in IMG/M |
3300009782 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG | Engineered | Open in IMG/M |
3300011391 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT163_2 | Environmental | Open in IMG/M |
3300011407 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT454_2 | Environmental | Open in IMG/M |
3300011408 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2 | Environmental | Open in IMG/M |
3300012161 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2 | Environmental | Open in IMG/M |
3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300013502 | Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M81612 | Engineered | Open in IMG/M |
3300014149 | In situ water column microbial community from the vent pool of Chocolate Pots hot spring, Yellowstone National Park, Wyoming, USA - CP Vent Pool | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300023201 | Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? PN | Engineered | Open in IMG/M |
3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
3300025017 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-20 (SPAdes) | Environmental | Open in IMG/M |
3300025826 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-01 (SPAdes) | Environmental | Open in IMG/M |
3300025855 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027776 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes) | Engineered | Open in IMG/M |
3300027786 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes) | Engineered | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300028283 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36m | Environmental | Open in IMG/M |
3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300028674 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_1 | Environmental | Open in IMG/M |
3300028804 | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt | Engineered | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033415 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.062E | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033420 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.152B | Environmental | Open in IMG/M |
3300033446 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.202 | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033498 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2017.111B | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300034349 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_18 | Environmental | Open in IMG/M |
3300034627 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2017.108B | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB_PC08_66DRAFT_100640351 | 3300000228 | Groundwater | GAIPSIFLRLSIFPVGRRPAARPSAGNANRCAASSQITNLKLEFHE* |
TB_FS06_10DRAFT_10112863 | 3300000233 | Groundwater | MAKNGLTKRAPDAGDSGVIPSIFLRLIIFPVGRRPAARPSAGNANR* |
TB_PC08_3DRAFT_10485763 | 3300000235 | Groundwater | PDAGDSGVIPSLFLRLSIFPVGRRSAARPSAGNANRWALGKLIQKEQ* |
TB_PC08_3DRAFT_10495021 | 3300000235 | Groundwater | MRPTKRAPDAGDSAQISSSFLRLSILPGGRRPAARPSAGNANR |
TB_FS08_3DRAFT_10122742 | 3300000236 | Groundwater | MAYGIVRCPTKRAPDAGDSGAIPSIFLRLSIFPVGRRSAARPSAGNANR* |
Draft_100305323 | 3300001580 | Hydrocarbon Resource Environments | MPIKRASDAGDSAQIPSSFLRLFIFLVGRLRRPHPGAGKANR* |
MIS_10613081 | 3300002024 | Sinkhole Freshwater | SCIIKKTRLTKRAPDAGDSGAISSIFLRLSIFPVGRHSAARPSAGNANR* |
MIS_11475981 | 3300002024 | Sinkhole Freshwater | QQAGCLTKRAPDAGDSGAIPSLFLRLSIFPGGRRSAARPSAGNANR* |
MIS_100438571 | 3300002027 | Sinkhole Freshwater | PTKRAPDAGDSGAIPSLFLRLILFPVGRRSAARPSAGNANR* |
P52013CM_10127311 | 3300003465 | Ore Pile And Mine Drainage Contaminated Soil | TKRAPDAGESGAIPSIFLRLIIFPVGRCSAARPSAGNANRWLASLEQNQ* |
Ga0071116_11796013 | 3300005077 | Sinkhole | DSGAIPSIFLRLSIFPVGRRSAARPSAGNANRWQELALNLSSSFKN* |
Ga0071116_11819303 | 3300005077 | Sinkhole | MSLAKFGCPTKRAPDAGDSAHIPGSFLRLSFFLAGRLRRPRPSAGNANRWA |
Ga0071116_11916141 | 3300005077 | Sinkhole | RPTKRAPDAGDSAAFSSIFLRLSIFPIGRRPAVRPSAGNANRWALRGEK* |
Ga0071116_12276872 | 3300005077 | Sinkhole | MNSQDVIMHLKKRLTKRAPDAGDSGTIPSLFLRLSIFPVGRRSAARPSAGNANR* |
Ga0073902_103100321 | 3300005656 | Activated Sludge | PTKRAPDAGDSAAISSSFLRLIIFLVGRLRRPRPSAGNANR* |
Ga0074474_11559192 | 3300005824 | Sediment (Intertidal) | PTKRAPDAGESGAIPSIFLRLSIFPVGRRPAARPSAGNANRWAVK* |
Ga0074478_13415262 | 3300005827 | Sediment (Intertidal) | MSLFIQKRPTKRAPDAGESGAIPSLFLRLSIFPVGRRSAARPSAGNANR* |
Ga0074479_107230221 | 3300005829 | Sediment (Intertidal) | MAKYGLTKRAPDAGESGAIPSFFLRLSIFPVGRRPAARPSAG |
Ga0074473_107847711 | 3300005830 | Sediment (Intertidal) | MLTVKPKRWLTKRAPDAGDSGAIPSLFLRLSLFPVGRRSAARPN |
Ga0074473_109167671 | 3300005830 | Sediment (Intertidal) | LTKRASDAGESGDLSSSFLRLVIFPVGRRSAARPSAGNANRWAVWQGLEK* |
Ga0075279_100232781 | 3300005903 | Rice Paddy Soil | MAHPTKRAPDAGDSGAIPSSFLRLIIFHIGRRSAARPSAGNANRW |
Ga0075157_102759922 | 3300005961 | Wastewater Effluent | LTKRAPDAGDSAAISSSFLRLIIFPVGRLRRPRPSAGNANRWAVRPQTTK* |
Ga0075156_100089391 | 3300005982 | Wastewater Effluent | KRAPDAGDSGAIPSIFLRLIFFHFGRRPAARPSAGNANR* |
Ga0075156_100353244 | 3300005982 | Wastewater Effluent | MSLAKNGWLTKRAPDAGDSAAISSSFLRLSIFLAGRLRRPRPSAGNANRW |
Ga0075156_100491701 | 3300005982 | Wastewater Effluent | TKRAPDAGDSAAISSSFTRLVIFLVGRLRRPRPSAGNANR* |
Ga0075156_100697134 | 3300005982 | Wastewater Effluent | KRAPDAGDSGEISSSFLRLSLFLAGRLRRPRPSAGNANRSAASQQA* |
Ga0075156_101739123 | 3300005982 | Wastewater Effluent | CPTKRAPDAGDSAAISGSFLRLSLFPVGRLRRPRPSAGNANRWAFPCKIF* |
Ga0075156_102161091 | 3300005982 | Wastewater Effluent | TKRAPDAGESAQIPSSFLRLIIFPVGRRSAARPSAGNANR* |
Ga0075156_102383603 | 3300005982 | Wastewater Effluent | MYLINNSSPTKRAPDAGESGAIPSLFLRLSIFPVGRRSAARPSAGNA |
Ga0075156_102698662 | 3300005982 | Wastewater Effluent | APDAGDSAHIPSSFSRLIIFLAGRLRRPHPSAGNANR* |
Ga0075154_105149872 | 3300005989 | Wastewater Effluent | KRAPDAGDSAAISSSFLRLSIFLVGRLRRPRPSAGNANRWADNSVGIL* |
Ga0075012_104655172 | 3300006033 | Watersheds | MQKRHLTKRAPDAGDSGAIPSIFLRLSIFPVGRRPAARPSAGNANR |
Ga0075012_109428772 | 3300006033 | Watersheds | VRLTKRAPDAGDSAAISSSFLRLIIFLAGRLRRPRPSAGNANR |
Ga0075163_104021451 | 3300006056 | Wastewater Effluent | KRAPDAGDSAAISSIFLRLSLFPGGRRPAARPSAGNANR* |
Ga0075163_108121191 | 3300006056 | Wastewater Effluent | CPTKRAPDAGDSAQIPSSFLRLFIFLAGRLRRPSPSAGNAIR* |
Ga0075163_111189282 | 3300006056 | Wastewater Effluent | TKRAPDAGDSAAISSSFLRLFIFPVGRLRRPRPSAGNANRWAAQVDKL* |
Ga0075163_112143823 | 3300006056 | Wastewater Effluent | TKRAPDAGDSAAISGSFPRLIIFPVGRLRRPRPSAGNANR* |
Ga0082021_11946015 | 3300006092 | Wastewater Treatment Plant | LQIKSVPTKRAPDAGDSAAFSGIFLRLIISLAGRLRRPRPSAGNANR* |
Ga0069787_100856531 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | GDSGAIPSIFLRLILFPVGRRPAARPSAGNANRWQELAVNL* |
Ga0079218_109748072 | 3300007004 | Agricultural Soil | MLLKDSVVSSQKHCPTKRAPGAGDSGAIPSIFLRLSIFPVGRRFAAHPSAGNANR* |
Ga0073932_10622971 | 3300007072 | Hot Spring Sediment | TKRAPDAGDSAHISSSFLRLIFFLAGRLRRPRPSAGNANRWLAAMP* |
Ga0105105_100465352 | 3300009009 | Freshwater Sediment | IRKKIRVGSQEKRLTKRAPDAGESGAIPSIFLRLSLFPVGRRSAARPSAGNANR* |
Ga0105105_106024441 | 3300009009 | Freshwater Sediment | KRAPDAGDSGAIPNIFLRLSLFPVGRRPAARPSAGNANRY* |
Ga0105093_103658552 | 3300009037 | Freshwater Sediment | GAPDAGDSGAIPGIFLRLSIFPVGRRSAARPSAGNANR* |
Ga0105091_102844581 | 3300009146 | Freshwater Sediment | MNELRLNRIPTKRRPTKRAPDAGESAAIPSIFLRLSIFPVGRRPAA |
Ga0105091_103602152 | 3300009146 | Freshwater Sediment | MHNKHSPTKRAPDAGESGAIPSLFLRLVIFPVGRLRRPRP |
Ga0103747_101663972 | 3300009295 | Wastewater Sludge | MSTTQRRLTKRAPDAGDSAVVPSSFLRLSIFLVGRLRRPRPSAGNANR |
Ga0116157_104480042 | 3300009782 | Anaerobic Digestor Sludge | CLTKRAPDAGDSAAISSSFTRLVIFLAGRLRRPRPSAGNAIRWAAL* |
Ga0137331_10124101 | 3300011391 | Soil | TKRAPDAGDSGAIPSIFLRLSIFPVGRRPAARPSAGNANR* |
Ga0137450_10410761 | 3300011407 | Soil | HDAGDSAQISGSFLRLSIFPVGRIRRPRPSAGNANR* |
Ga0137460_10450723 | 3300011408 | Soil | APDAGESGAIPSLFLRLSLFPVGRRPAARPSAGNANRWAVLGTTGD* |
Ga0137336_10448532 | 3300012161 | Soil | MSLQFIQRLTQRAPDAGESAHISGSFLRLIIFLAGRLRRPRPS |
Ga0137357_10793202 | 3300012168 | Soil | LTKRAPDAGDSGAIPSLFLRLSIFPVGQRPAARPSAGNANR* |
Ga0138256_103045251 | 3300012533 | Active Sludge | MNASSTQQRPTKRAPDAGESAAISGSFLRLSIFLAGRLRRPRPSAGNANRWA |
Ga0138256_103636471 | 3300012533 | Active Sludge | IEKSRLTKRAPDAGDSGAIPSIFLRLSIFPVGRRSAARPSAGNANR* |
Ga0138256_105445733 | 3300012533 | Active Sludge | MRPTKRAPDAGESAQISSSFLRLFIFLAGRLRRPHPSAGNANR |
Ga0138256_106370332 | 3300012533 | Active Sludge | RRLTKRAPDAGDSAHIPSSFPRLIIFPVGRLRRPHPSAGNANR* |
Ga0138256_109737842 | 3300012533 | Active Sludge | MAKSGLTKRAPDAGDSAQIPGSFLRLIIFLAGRLRRPHPSAGNANRWA |
Ga0138256_112094662 | 3300012533 | Active Sludge | MFSKVEKRLTKRAPDAGDSGAIPSLFLRLSLFPIGRHPAARPSAGNA |
(restricted) Ga0172368_103274971 | 3300013123 | Freshwater | PDAGDSAHIPSSFLRLFIFQVGRLRRPRPSAGNANRWQELALNL* |
(restricted) Ga0172367_100503204 | 3300013126 | Freshwater | MIKSRRTKRAPDAGDSAHIPSSFTRLSIFLVGRLRRPRPSAGNANRSAAVAK* |
(restricted) Ga0172367_100571241 | 3300013126 | Freshwater | VTLKTKSVPTKRAPDAGDSAAISSSFLRLILFLAGRLRRPRPSAGNAIR* |
(restricted) Ga0172367_101433401 | 3300013126 | Freshwater | MQKHRLTKRAPDAGDSAHIPSSFLRLIIFLAGRLRRPRPSAGNANR |
(restricted) Ga0172367_104312651 | 3300013126 | Freshwater | TKRAPDAGDSAAISSSFLRLIIFLAGRLRRPRPSAGNANR* |
(restricted) Ga0172373_100512561 | 3300013131 | Freshwater | KRAPDAGDSAVIPSIFLRLIIFQVGRLRRPRPSAGNANR* |
(restricted) Ga0172373_101134301 | 3300013131 | Freshwater | MLLNNKPRLTKRAPDAGDSAHIPSSFTRLIIFLAGRLRRPRPSAGNANR |
(restricted) Ga0172373_102742941 | 3300013131 | Freshwater | DAGDSGAIPSIFLRLILFPLGRRPAARPSAGNANR* |
(restricted) Ga0172373_105051351 | 3300013131 | Freshwater | KRAPDAGDSAAISSSFLRLIIFLAGRLRRPRPSAGNANR* |
(restricted) Ga0172375_104765491 | 3300013137 | Freshwater | MKKRPTKRAPDAGDSAAFSSSFLRLIVFLVGRLRRPRPSAGNANRW |
(restricted) Ga0172375_107897961 | 3300013137 | Freshwater | MPPNTACRLTKRAPDAGDSGAIPSLFLRLIIFPVGRLRRPRPSAGI |
Ga0119901_10931571 | 3300013502 | Activated Sludge | TKRAPDAGDSAAISSSFLRLFIFLAGRLRRPRPSAGNANRWALEN* |
Ga0181613_10058552 | 3300014149 | Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | MRQPTKRAPDAGESGAIPSLFLRLSIFPVGRRSAARPSAGNANRWAAKEQNWL* |
Ga0182021_116899422 | 3300014502 | Fen | LTKRAPDAGESGAIPSIFLRLVLFHFGRRPAARPSAGNANR* |
Ga0184615_100382954 | 3300018059 | Groundwater Sediment | TKRAPDAGDSAHIPSSFLRLIIFLVGRLRRPRPSAGNAIR |
Ga0184615_101173921 | 3300018059 | Groundwater Sediment | TLPKQWRGLTKRAPDAGESAQISSIFLRLSIFPVGRRSAARPSAGNANR |
Ga0184615_102393551 | 3300018059 | Groundwater Sediment | RPTKRAPDAGDSGAIPSSFLRLSIFPVGRRSAARPSAGNANRWAG |
Ga0184615_104483322 | 3300018059 | Groundwater Sediment | MRPTKRAPDAGDSAAISSSFLRLSIFLVGRLRRPRPSAGNANRWAARMTLSIQ |
Ga0184615_106517651 | 3300018059 | Groundwater Sediment | TKRAPDAGDSGAIPSSFPRLSIFPVGRLRAARPSAGNANRSAARFQRSSL |
Ga0210377_102413143 | 3300021090 | Groundwater Sediment | KRALDAGDSAHIPSSFLRLSLFLLGLGSPVRPSASNANRWAGT |
Ga0210377_104991482 | 3300021090 | Groundwater Sediment | TKRAPDAGDSAAISSSFLRLSIFPVGRRSAARPSAGNANR |
Ga0210377_105563731 | 3300021090 | Groundwater Sediment | ESGTMQKRLTKRAPDAGDSGAIPSLFLRLSIFPVGRRSAARPSAGNASR |
Ga0210377_105870372 | 3300021090 | Groundwater Sediment | NQAKRRLTKRAPDAGDSGAIPSSFPRLSIFPVGRLRAARPSAGNANRSAARFQRSSL |
Ga0256614_14036501 | 3300023201 | Activated Sludge | PDAGDSGEIPSSFLRLIIFPVGRRSAVRPSAGNANR |
(restricted) Ga0233425_100321795 | 3300024054 | Freshwater | PTKRAPDAGDSAAISSSFLRLSLFLVGRLRRPRPSAGNANRWLASQQFLI |
Ga0210022_10249704 | 3300025017 | Aquifer | KRAPDAGDSGAIPSLFLRLSIFPVGRRSAARPSAGNANR |
Ga0210033_10127416 | 3300025826 | Aquifer | MSLQVQPRLTKRAPDAGDSGAIPSSFLRLSIFPVGRRSAARPSAGNANR |
Ga0209717_13093852 | 3300025855 | Anaerobic Digestor Sludge | KQAGCLTKRAPDAGDSAAISSSFTRLVIFLAGRLRRPRPSAGNAIRWAAL |
Ga0209575_101338152 | 3300027739 | Freshwater | KRAPDAGDSAAISGSFLRLIIFQVGRLRRPHPSAGNANR |
Ga0209277_100693042 | 3300027776 | Wastewater Effluent | MSLAKNGWLTKRAPDAGDSAAISSSFLRLSIFLAGRLRRPRPSAGNANRWLAPCESKNVEEY |
Ga0209812_103497772 | 3300027786 | Wastewater Effluent | NDKYKKRPTKRAPDAGDSAVISISFLRLSIFLAGRLRRPRPSAGNANRWAVPGIKGCQ |
Ga0209287_101881762 | 3300027792 | Freshwater Sediment | SKVKSGLTKRAPDAGDSAAISSSFPRLSIFPVGRLRRPRPSAGNANR |
Ga0209287_102044771 | 3300027792 | Freshwater Sediment | MRPTQRAPDAGDSGAIPSSFLRLIIFPVGRRPAARPSAGNANRS |
Ga0208980_102825242 | 3300027887 | Wetland | RLTKRAPDAGDSGAIPSLFLRLSFFPVGRRSAARPSAGNANRWAFALQKFTFFL |
Ga0209496_102247961 | 3300027890 | Wetland | GESGAIPSIFLRLILFPVGRRPAARPSAGNANRWASLAQQHSTSL |
Ga0209253_111878671 | 3300027900 | Freshwater Lake Sediment | FGTIQAILVKGWRQLTKRAPDAGDSGAIPSIFLRLSIFPVGRRPAARPSAGNANR |
Ga0268283_10405244 | 3300028283 | Saline Water | TKRAPDAGDSAAFSSIFLRLSIFPIGRRSAARPSAGNANRWVAEKCIKS |
Ga0272412_10125467 | 3300028647 | Activated Sludge | MKRPTKRAPDAGDSAHIPSSFLRLIIFLAGRLRRPRPSAGNANRWAL |
Ga0272412_11870731 | 3300028647 | Activated Sludge | MVNPKTSSRNKSRLTKRASDAGDSAHIPSSFLRLTIFLVGRLRRPRPSAGN |
Ga0302161_100238391 | 3300028674 | Fen | RAPDAGDSGAIPSLFLRLSIFPVGRRSAARPSAGNANR |
Ga0302161_101094271 | 3300028674 | Fen | DAGDSAAISSSFLRLSIFPVGRRSAAHPSAGNANR |
Ga0268298_100091878 | 3300028804 | Activated Sludge | MKKRPTKRAPDAGDSAHIPGSFLRLSLFLAGRLRRPRPSAGNANR |
Ga0268298_100193072 | 3300028804 | Activated Sludge | MAKSGLTKRAPDAGDSAAISGSFLRLIIFLAGRLRRPRPSAGNASR |
Ga0268298_100196821 | 3300028804 | Activated Sludge | GLTKRAPDAGDSAHIPGSLLRLIIFLAGRLRRPRPSAGNANR |
Ga0268298_100218667 | 3300028804 | Activated Sludge | MVYEHLKYGNLTKRAPDAGDSGENLKHFSRLSIFLAGRLRRPRPSAGNANR |
Ga0268298_100360741 | 3300028804 | Activated Sludge | SCVQQNCPTKRAPDAGDSGAIPSIFLRLSIFPVGRRPAARPSAGNANR |
Ga0268298_100400801 | 3300028804 | Activated Sludge | KRAPDAGDSAAISSSFTRLIIFLAGRLRRPRPSAGNANRWALKFYGESISEK |
Ga0268298_100481286 | 3300028804 | Activated Sludge | LTKRAPDAGDSAAISSSFPRLIIFPVGRLRRPRPSAGNANR |
Ga0268298_100488351 | 3300028804 | Activated Sludge | MNNCLSVKKHRLTKRAPDAGDSAHISSGSLRFIIFLAGRLRRPRPSAGN |
Ga0268298_100867621 | 3300028804 | Activated Sludge | TKRAPDAGDSAAISSSFLRLIIFLVGRLRRPRPSAGNANRWVLR |
Ga0268298_101545831 | 3300028804 | Activated Sludge | MAGKKIKSKPTKRAPDAGDSGAIPSLFLRLSIFPVGRRPAARPSAGNANR |
Ga0268298_101863771 | 3300028804 | Activated Sludge | APDAGDSAHTPGSFTRLVIFLAGRLRRPRPSAGNANRWHAPSSPEF |
Ga0268298_102065461 | 3300028804 | Activated Sludge | MQVLRCERLTKRAPDAEDSAARFASGSFLRLIIFLAGRLRRPRPS |
Ga0268298_102190611 | 3300028804 | Activated Sludge | VKKRRPTKRAPDAGDSAHIPGIFPRLSLFLAGRLRRPRPSAGNANR |
Ga0268298_102473142 | 3300028804 | Activated Sludge | VPTKRAPDAGESGAIPSLFLRLSIFPVGRRPAARPSAGNANRWALAH |
Ga0268298_102813991 | 3300028804 | Activated Sludge | MHNEKRLTKRAPDAGESAHIPSSFLRLVIFLAGRLRRPRPSAGNANRW |
Ga0268298_103646852 | 3300028804 | Activated Sludge | MRLTKRAPDAGESAAISSSFLRLIIFLAGRLRRPRPSAGNANR |
Ga0268298_106196341 | 3300028804 | Activated Sludge | MRPTKRAPDAGDSAQISSSFTRLIIFLAGRLRRPRPSAGNANR |
Ga0311336_108593212 | 3300029990 | Fen | PTKRAPDAGESGAILSLFLRLIIFPVGRRSAARPSAGNANRWALRFYVTIQYSTGL |
Ga0311337_110204001 | 3300030000 | Fen | VVCLPGVRLTKRAPDAGESGAIPSLFLRLIIFPVGRRPAARPSAGNANRWAA |
Ga0311333_105477921 | 3300030114 | Fen | VVCLPGVRLTKRAPDAGESGAIPSLFLRLIIFPVGRRPAARPSAGNANRWA |
Ga0311333_105984763 | 3300030114 | Fen | TQRAPDAGESAHISGSFLRLSIFPVGRLRRPRPSAGNANR |
Ga0311333_116740791 | 3300030114 | Fen | ESCASQKRPTKRALDAGESAAISSSFLRLIIFPIGRRPAAHPSASNANR |
Ga0311366_112333501 | 3300030943 | Fen | IGMDNAVIIKSGLTKRAPDAGDSGAIPSSFLRLSTFPVGRRSAAHPSAGNANR |
Ga0302323_1001775554 | 3300031232 | Fen | NKVAAKKRPTKRAPDAGDSGAIPSIFLRLSIFLVGRRPAARPSAGNANR |
Ga0311364_107832411 | 3300031521 | Fen | QKRPTKRALDAGESAAISSSFLRLIIFPIGRRPAAHPSASNANR |
Ga0302321_1003451733 | 3300031726 | Fen | IFLGLPLCLAQQKKRLTKRAPDAGDSAAISSSFLRLIIFLARRLRRPRPSTSNANR |
Ga0302321_1019468922 | 3300031726 | Fen | DAGDSAAFSSIFLRLSIFPIGRRSAARPSAGNANR |
Ga0302322_1011593052 | 3300031902 | Fen | PTPRALDAGDSAAFSSSFLRLIIFPIGRRPAARPSASNANRWVAGHKITKG |
Ga0302322_1030080402 | 3300031902 | Fen | VSRKPIKRLTKRALDAGDSAAISSSFLRLIIFPVGRRSAARPS |
Ga0315281_116733021 | 3300032163 | Sediment | VILQLSSGTTKRAPDAGDSGAIPSLFLRLSIFPVGRRPAARPSAGNAN |
Ga0315268_106480171 | 3300032173 | Sediment | LTKRAPDAGDSAAFSSIFLRLSIFPIGQHSAARPSAGNANRWLA |
Ga0315273_100001041 | 3300032516 | Sediment | MSLQFSPRLTKRAPDAGDSGAIPSLFLRLSIFPVGRRPAARPSAGN |
Ga0214472_108271701 | 3300033407 | Soil | AQSQPTKRAPDAGDSGAISSLFLRLSIFPVGRRSAARPSAGNANR |
Ga0316619_101856662 | 3300033414 | Soil | MRPTQRAPDAGDSGAIPGIFLRLSIFPVGRRPAARPSAGNA |
Ga0316607_10658571 | 3300033415 | Microbial Mat | DAGDSAAFSSLFLRLNLFPIGRRPAARPSAGNANR |
Ga0316625_1006519331 | 3300033418 | Soil | MSKSGLTKRAPDAGDSGAIPSLFLRLSIFPVGRRNAVRPSAGNAN |
Ga0316608_10605453 | 3300033420 | Microbial Mat | MLLYSKHRPTKRAPDAGDSGAIPSIFLRLSIFPVGRRPAARPSAGNA |
Ga0316608_10734651 | 3300033420 | Microbial Mat | PDAGDSGAIPSLFLRLIIFPVGRRSAARPSAGNANRWQELAVNLSSSFKN |
Ga0316608_10771481 | 3300033420 | Microbial Mat | QNRRLTKRAPDAGDSGAIPSIFLRLIIFPVGRRSAARPSAGNANR |
Ga0316611_10135261 | 3300033446 | Microbial Mat | SGQQAGCLTKRAPDAGDSGAIPSLFLRLSIFPIGRRSAARPSAGNANR |
Ga0316611_10269432 | 3300033446 | Microbial Mat | KHKRQPTKRAPDAGDSAAFSSLFLRLSLFPVGRRSAAHPSAGNANR |
Ga0316611_10338233 | 3300033446 | Microbial Mat | KRAPDAGDSGAIPSIFLRLSIFPVGRRSAARPSAGNANR |
Ga0316627_1000567504 | 3300033482 | Soil | MDKKRLTKRAPDAGESAQISGSFLRFIIFLAGRLRRPRRSAGNAIR |
Ga0316627_1023230611 | 3300033482 | Soil | MITNITKSGLTQRAPDVWESARFTSIFLHLSIFPVGRRPAARPSAGN |
Ga0316621_111661022 | 3300033488 | Soil | MHENKRPTKRAPDAGDSAQISSSFLRLSIFPIGRRPAARPSAGNANRW |
Ga0316610_10508481 | 3300033498 | Microbial Mat | LKAKSKPTKRAPDAGDSGAIPSIFLRLSLFPVGRRPAARPSAGNANRWV |
Ga0316610_10618743 | 3300033498 | Microbial Mat | GCLTKRAPDAGDSGAIPSIFLRLSIFPVGRRPAARPSAGNANRWAVGK |
Ga0316610_10766972 | 3300033498 | Microbial Mat | LTLPPDAGDSGAIPSLFLRLILFPVGRRPAARPSAGNANR |
Ga0316610_10944071 | 3300033498 | Microbial Mat | RAPDAGDSGAIPSIFPRLSIFPVGRRSAARPSAGNANRWADTL |
Ga0316616_1006791895 | 3300033521 | Soil | KRALGTGESAQISGSFLRLSLFLAGRLRRPRPSAMLRKRKR |
Ga0370504_0149887_530_664 | 3300034349 | Untreated Peat Soil | MRLPITSAPTKRAPDAGESGAIPSLFLRLSIFPIGRRSAARPSAG |
Ga0316609_007615_2_142 | 3300034627 | Microbial Mat | RAPDAGDSAPFSSSFLRLSLFPIGRRPAARPSAGNANRWQELALNL |
Ga0316609_043688_3_152 | 3300034627 | Microbial Mat | GSGQQAGCLTKRAPDAGDSGAISSLFLRLSIFPVGRRSAARPSAGNANR |
Ga0316609_095744_434_541 | 3300034627 | Microbial Mat | DAGDSGAIPSIFLRLIIFPVGRRPAARPSAGNANR |
⦗Top⦘ |