| Basic Information | |
|---|---|
| Family ID | F023595 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 209 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MVDFGSEQGLSDFETAGIARYFEDFKRAKTPLWAKRCRLWMDTK |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 209 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.22 % |
| % of genes near scaffold ends (potentially truncated) | 59.81 % |
| % of genes from short scaffolds (< 2000 bps) | 80.38 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment (20.574 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.967 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (26.316 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 209 Family Scaffolds |
|---|---|---|
| PF09723 | Zn-ribbon_8 | 1.44 |
| PF06415 | iPGM_N | 1.44 |
| PF10609 | ParA | 1.44 |
| PF00682 | HMGL-like | 0.96 |
| PF00155 | Aminotran_1_2 | 0.96 |
| PF01895 | PhoU | 0.96 |
| PF08359 | TetR_C_4 | 0.96 |
| PF01654 | Cyt_bd_oxida_I | 0.96 |
| PF01592 | NifU_N | 0.96 |
| PF00324 | AA_permease | 0.96 |
| PF00881 | Nitroreductase | 0.96 |
| PF02416 | TatA_B_E | 0.96 |
| PF02653 | BPD_transp_2 | 0.96 |
| PF00072 | Response_reg | 0.96 |
| PF02589 | LUD_dom | 0.96 |
| PF01676 | Metalloenzyme | 0.96 |
| PF07085 | DRTGG | 0.96 |
| PF01964 | ThiC_Rad_SAM | 0.48 |
| PF01155 | HypA | 0.48 |
| PF00501 | AMP-binding | 0.48 |
| PF13561 | adh_short_C2 | 0.48 |
| PF01343 | Peptidase_S49 | 0.48 |
| PF00149 | Metallophos | 0.48 |
| PF14691 | Fer4_20 | 0.48 |
| PF00108 | Thiolase_N | 0.48 |
| PF04267 | SoxD | 0.48 |
| PF03480 | DctP | 0.48 |
| PF04060 | FeS | 0.48 |
| PF00137 | ATP-synt_C | 0.48 |
| PF00118 | Cpn60_TCP1 | 0.48 |
| PF02646 | RmuC | 0.48 |
| PF08360 | TetR_C_5 | 0.48 |
| PF12327 | FtsZ_C | 0.48 |
| PF08668 | HDOD | 0.48 |
| PF00005 | ABC_tran | 0.48 |
| PF00675 | Peptidase_M16 | 0.48 |
| PF14535 | AMP-binding_C_2 | 0.48 |
| PF02321 | OEP | 0.48 |
| PF01012 | ETF | 0.48 |
| PF02518 | HATPase_c | 0.48 |
| PF09695 | YtfJ_HI0045 | 0.48 |
| PF00009 | GTP_EFTU | 0.48 |
| PF03088 | Str_synth | 0.48 |
| PF01728 | FtsJ | 0.48 |
| PF13193 | AMP-binding_C | 0.48 |
| PF01797 | Y1_Tnp | 0.48 |
| PF01706 | FliG_C | 0.48 |
| PF13514 | AAA_27 | 0.48 |
| PF00085 | Thioredoxin | 0.48 |
| PF03358 | FMN_red | 0.48 |
| PF08245 | Mur_ligase_M | 0.48 |
| PF08843 | AbiEii | 0.48 |
| PF13847 | Methyltransf_31 | 0.48 |
| PF06245 | DUF1015 | 0.48 |
| PF13426 | PAS_9 | 0.48 |
| PF02579 | Nitro_FeMo-Co | 0.48 |
| PF00571 | CBS | 0.48 |
| PF07509 | DUF1523 | 0.48 |
| PF01656 | CbiA | 0.48 |
| PF12837 | Fer4_6 | 0.48 |
| PF00011 | HSP20 | 0.48 |
| PF03544 | TonB_C | 0.48 |
| PF01558 | POR | 0.48 |
| PF01048 | PNP_UDP_1 | 0.48 |
| PF06429 | Flg_bbr_C | 0.48 |
| PF02780 | Transketolase_C | 0.48 |
| PF16916 | ZT_dimer | 0.48 |
| PF02782 | FGGY_C | 0.48 |
| PF01612 | DNA_pol_A_exo1 | 0.48 |
| PF02915 | Rubrerythrin | 0.48 |
| PF01880 | Desulfoferrodox | 0.48 |
| PF00834 | Ribul_P_3_epim | 0.48 |
| PF02082 | Rrf2 | 0.48 |
| PF00465 | Fe-ADH | 0.48 |
| PF08501 | Shikimate_dh_N | 0.48 |
| PF09924 | LPG_synthase_C | 0.48 |
| PF13188 | PAS_8 | 0.48 |
| PF09505 | Dimeth_Pyl | 0.48 |
| PF06827 | zf-FPG_IleRS | 0.48 |
| PF01804 | Penicil_amidase | 0.48 |
| PF02635 | DrsE | 0.48 |
| PF00456 | Transketolase_N | 0.48 |
| PF00583 | Acetyltransf_1 | 0.48 |
| PF00903 | Glyoxalase | 0.48 |
| PF07992 | Pyr_redox_2 | 0.48 |
| PF02880 | PGM_PMM_III | 0.48 |
| PF02592 | Vut_1 | 0.48 |
| PF04290 | DctQ | 0.48 |
| PF01694 | Rhomboid | 0.48 |
| PF12146 | Hydrolase_4 | 0.48 |
| PF12724 | Flavodoxin_5 | 0.48 |
| PF00464 | SHMT | 0.48 |
| PF13614 | AAA_31 | 0.48 |
| PF02493 | MORN | 0.48 |
| PF03588 | Leu_Phe_trans | 0.48 |
| PF02887 | PK_C | 0.48 |
| PF12654 | DUF3786 | 0.48 |
| PF13649 | Methyltransf_25 | 0.48 |
| PF00925 | GTP_cyclohydro2 | 0.48 |
| PF13676 | TIR_2 | 0.48 |
| PF07690 | MFS_1 | 0.48 |
| PF10431 | ClpB_D2-small | 0.48 |
| PF12281 | NTP_transf_8 | 0.48 |
| PF03063 | Prismane | 0.48 |
| PF01476 | LysM | 0.48 |
| PF08443 | RimK | 0.48 |
| PF13407 | Peripla_BP_4 | 0.48 |
| PF00438 | S-AdoMet_synt_N | 0.48 |
| PF02219 | MTHFR | 0.48 |
| PF01790 | LGT | 0.48 |
| PF02604 | PhdYeFM_antitox | 0.48 |
| PF00860 | Xan_ur_permease | 0.48 |
| PF04392 | ABC_sub_bind | 0.48 |
| PF04358 | DsrC | 0.48 |
| PF05598 | DUF772 | 0.48 |
| PF01042 | Ribonuc_L-PSP | 0.48 |
| PF02618 | YceG | 0.48 |
| PF00892 | EamA | 0.48 |
| PF01243 | Putative_PNPOx | 0.48 |
| PF13247 | Fer4_11 | 0.48 |
| PF02661 | Fic | 0.48 |
| PF07731 | Cu-oxidase_2 | 0.48 |
| PF13414 | TPR_11 | 0.48 |
| PF03951 | Gln-synt_N | 0.48 |
| PF06969 | HemN_C | 0.48 |
| PF00694 | Aconitase_C | 0.48 |
| PF13404 | HTH_AsnC-type | 0.48 |
| PF13440 | Polysacc_synt_3 | 0.48 |
| PF00849 | PseudoU_synth_2 | 0.48 |
| PF14803 | Nudix_N_2 | 0.48 |
| PF00347 | Ribosomal_L6 | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 209 Family Scaffolds |
|---|---|---|---|
| COG0696 | Phosphoglycerate mutase (BPG-independent), AlkP superfamily | Carbohydrate transport and metabolism [G] | 1.44 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.96 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.96 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.96 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.96 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.96 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.96 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.96 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.48 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.48 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.48 |
| COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.48 |
| COG2033 | Desulfoferrodoxin, superoxide reductase-like (SORL) domain | Energy production and conversion [C] | 0.48 |
| COG1749 | Flagellar hook protein FlgE | Cell motility [N] | 0.48 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.48 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.48 |
| COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG1558 | Flagellar basal body rod protein FlgC | Cell motility [N] | 0.48 |
| COG1536 | Flagellar motor switch protein FliG | Cell motility [N] | 0.48 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.48 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.48 |
| COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 0.48 |
| COG4787 | Flagellar basal body rod protein FlgF | Cell motility [N] | 0.48 |
| COG4786 | Flagellar basal body rod protein FlgG | Cell motility [N] | 0.48 |
| COG4642 | Uncharacterized conserved protein | Function unknown [S] | 0.48 |
| COG4311 | Sarcosine oxidase delta subunit | Amino acid transport and metabolism [E] | 0.48 |
| COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 0.48 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.48 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.48 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.48 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.48 |
| COG2920 | Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C) | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.48 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.48 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.48 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.48 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.48 |
| COG2360 | Leu/Phe-tRNA-protein transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.48 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.48 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.48 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.48 |
| COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.48 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.48 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 0.48 |
| COG0375 | Hydrogenase maturation factor HypA/HybF, metallochaperone involved in Ni insertion | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.48 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.48 |
| COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.48 |
| COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 0.48 |
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.48 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.48 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.48 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.48 |
| COG0097 | Ribosomal protein L6P/L9E | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 0.48 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.48 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG1256 | Flagellar hook-associated protein FlgK | Cell motility [N] | 0.48 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.48 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG1152 | CO dehydrogenase/acetyl-CoA synthase alpha subunit | Energy production and conversion [C] | 0.48 |
| COG1151 | Hydroxylamine reductase (hybrid-cluster protein) | Energy production and conversion [C] | 0.48 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.48 |
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.48 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.48 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.48 |
| COG0807 | GTP cyclohydrolase II | Coenzyme transport and metabolism [H] | 0.48 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.48 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 0.48 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.48 |
| COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 0.48 |
| COG0635 | Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductase | Coenzyme transport and metabolism [H] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.21 % |
| Unclassified | root | N/A | 26.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10174300 | Not Available | 514 | Open in IMG/M |
| 3300000872|JGI12365J12839_1000700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 9325 | Open in IMG/M |
| 3300000872|JGI12365J12839_1001085 | All Organisms → cellular organisms → Bacteria | 4667 | Open in IMG/M |
| 3300000920|JGI12573J12842_1000126 | All Organisms → cellular organisms → Bacteria | 54648 | Open in IMG/M |
| 3300000920|JGI12573J12842_1000165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 46129 | Open in IMG/M |
| 3300000920|JGI12573J12842_1000233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 34265 | Open in IMG/M |
| 3300000920|JGI12573J12842_1000348 | All Organisms → cellular organisms → Bacteria | 24258 | Open in IMG/M |
| 3300000920|JGI12573J12842_1000563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13504 | Open in IMG/M |
| 3300000920|JGI12573J12842_1000708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 9312 | Open in IMG/M |
| 3300000920|JGI12573J12842_1003853 | Not Available | 1364 | Open in IMG/M |
| 3300001685|JGI24024J18818_10006019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5031 | Open in IMG/M |
| 3300001685|JGI24024J18818_10138090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 736 | Open in IMG/M |
| 3300002052|SMTZ1_10030859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 5083 | Open in IMG/M |
| 3300003142|Ga0052242_1023284 | Not Available | 860 | Open in IMG/M |
| 3300003777|Ga0049110_10063389 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 800 | Open in IMG/M |
| 3300003817|Ga0056122_10037121 | Not Available | 1046 | Open in IMG/M |
| 3300004109|Ga0008650_1058783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1055 | Open in IMG/M |
| 3300004212|Ga0066631_10091780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1424 | Open in IMG/M |
| 3300004974|Ga0066617_1274712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans | 673 | Open in IMG/M |
| 3300005588|Ga0070728_10007992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 9498 | Open in IMG/M |
| 3300005600|Ga0070726_10003389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 13414 | Open in IMG/M |
| 3300005753|Ga0077776_1023412 | Not Available | 1762 | Open in IMG/M |
| 3300005917|Ga0075115_10124893 | Not Available | 922 | Open in IMG/M |
| 3300005917|Ga0075115_10289002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 554 | Open in IMG/M |
| 3300005920|Ga0070725_10440590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 583 | Open in IMG/M |
| 3300005932|Ga0075121_1040253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1711 | Open in IMG/M |
| 3300005932|Ga0075121_1070245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1197 | Open in IMG/M |
| 3300005932|Ga0075121_1179849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfoprunum → Desulfoprunum benzoelyticum | 649 | Open in IMG/M |
| 3300006467|Ga0099972_11025699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 561 | Open in IMG/M |
| 3300009035|Ga0102958_1321375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 542 | Open in IMG/M |
| 3300009138|Ga0102959_1215213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 623 | Open in IMG/M |
| 3300009145|Ga0102961_1143826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 636 | Open in IMG/M |
| 3300009374|Ga0118720_1022547 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 4285 | Open in IMG/M |
| 3300009506|Ga0118657_11977801 | Not Available | 674 | Open in IMG/M |
| 3300009509|Ga0123573_10240029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans | 1773 | Open in IMG/M |
| 3300009788|Ga0114923_10069979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2423 | Open in IMG/M |
| 3300009788|Ga0114923_10344029 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300009788|Ga0114923_10745968 | Not Available | 741 | Open in IMG/M |
| 3300009788|Ga0114923_11137755 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009788|Ga0114923_11138672 | Not Available | 603 | Open in IMG/M |
| 3300009788|Ga0114923_11286018 | Not Available | 569 | Open in IMG/M |
| 3300009788|Ga0114923_11346192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 556 | Open in IMG/M |
| 3300009941|Ga0132240_1055164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S5133MH16 | 589 | Open in IMG/M |
| 3300010298|Ga0126325_10000041 | All Organisms → cellular organisms → Bacteria | 48778 | Open in IMG/M |
| 3300010330|Ga0136651_10281464 | Not Available | 831 | Open in IMG/M |
| 3300010330|Ga0136651_10281686 | Not Available | 830 | Open in IMG/M |
| 3300010392|Ga0118731_100946879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 502 | Open in IMG/M |
| 3300010392|Ga0118731_107851412 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300010392|Ga0118731_112098202 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 570 | Open in IMG/M |
| 3300010430|Ga0118733_100598437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2194 | Open in IMG/M |
| 3300010430|Ga0118733_106797597 | Not Available | 596 | Open in IMG/M |
| 3300010430|Ga0118733_107466687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 567 | Open in IMG/M |
| 3300013098|Ga0164320_10128499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1122 | Open in IMG/M |
| 3300013098|Ga0164320_10129548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1118 | Open in IMG/M |
| 3300013098|Ga0164320_10157872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1025 | Open in IMG/M |
| 3300013098|Ga0164320_10287550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 787 | Open in IMG/M |
| 3300013098|Ga0164320_10477610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 631 | Open in IMG/M |
| 3300013098|Ga0164320_10512204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 612 | Open in IMG/M |
| 3300013098|Ga0164320_10628227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 561 | Open in IMG/M |
| 3300013098|Ga0164320_10775825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 514 | Open in IMG/M |
| 3300013098|Ga0164320_10792046 | Not Available | 509 | Open in IMG/M |
| 3300013099|Ga0164315_10155566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1862 | Open in IMG/M |
| 3300013099|Ga0164315_10219668 | Not Available | 1550 | Open in IMG/M |
| 3300013099|Ga0164315_10362250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1178 | Open in IMG/M |
| 3300013099|Ga0164315_10404123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1108 | Open in IMG/M |
| 3300013099|Ga0164315_10413539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1094 | Open in IMG/M |
| 3300013099|Ga0164315_10420172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1084 | Open in IMG/M |
| 3300013099|Ga0164315_10437189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1061 | Open in IMG/M |
| 3300013099|Ga0164315_10518169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus | 964 | Open in IMG/M |
| 3300013099|Ga0164315_10630698 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 862 | Open in IMG/M |
| 3300013099|Ga0164315_10715759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 802 | Open in IMG/M |
| 3300013099|Ga0164315_10945731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300013099|Ga0164315_10987015 | Not Available | 668 | Open in IMG/M |
| 3300013099|Ga0164315_11088878 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300013099|Ga0164315_11261016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 583 | Open in IMG/M |
| 3300013099|Ga0164315_11296185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 574 | Open in IMG/M |
| 3300013099|Ga0164315_11510500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 528 | Open in IMG/M |
| 3300013099|Ga0164315_11608152 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300013101|Ga0164313_10187856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1745 | Open in IMG/M |
| 3300013101|Ga0164313_10354642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1228 | Open in IMG/M |
| 3300013101|Ga0164313_10403013 | Not Available | 1142 | Open in IMG/M |
| 3300013101|Ga0164313_10534435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfogranum → Desulfogranum mediterraneum | 973 | Open in IMG/M |
| 3300013101|Ga0164313_10557491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 950 | Open in IMG/M |
| 3300013101|Ga0164313_10625704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 890 | Open in IMG/M |
| 3300013101|Ga0164313_11014808 | Not Available | 675 | Open in IMG/M |
| 3300013101|Ga0164313_11029545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 670 | Open in IMG/M |
| 3300013101|Ga0164313_11470957 | Not Available | 549 | Open in IMG/M |
| 3300013101|Ga0164313_11518861 | Not Available | 539 | Open in IMG/M |
| 3300013101|Ga0164313_11717820 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300013103|Ga0164318_11452943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 551 | Open in IMG/M |
| 3300013117|Ga0171658_1051222 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300014903|Ga0164321_10009903 | All Organisms → cellular organisms → Bacteria | 2837 | Open in IMG/M |
| 3300014903|Ga0164321_10675413 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300014914|Ga0164311_10611533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina ovata | 624 | Open in IMG/M |
| 3300014914|Ga0164311_10675937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus | 589 | Open in IMG/M |
| 3300017960|Ga0180429_10529973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 788 | Open in IMG/M |
| 3300017960|Ga0180429_10833648 | Not Available | 624 | Open in IMG/M |
| 3300017960|Ga0180429_10964038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 580 | Open in IMG/M |
| 3300017960|Ga0180429_11012848 | Not Available | 566 | Open in IMG/M |
| 3300017990|Ga0180436_11056733 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300017992|Ga0180435_10500313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1014 | Open in IMG/M |
| 3300017992|Ga0180435_10745038 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300017992|Ga0180435_10901889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 750 | Open in IMG/M |
| 3300017992|Ga0180435_11465338 | Not Available | 590 | Open in IMG/M |
| 3300017992|Ga0180435_11473669 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300018065|Ga0180430_10429833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatitalea → Desulfatitalea tepidiphila | 903 | Open in IMG/M |
| 3300018065|Ga0180430_10537099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 4 endosymbiont | 804 | Open in IMG/M |
| 3300018065|Ga0180430_10965399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 594 | Open in IMG/M |
| 3300018065|Ga0180430_11075981 | Not Available | 563 | Open in IMG/M |
| 3300018065|Ga0180430_11209660 | Not Available | 531 | Open in IMG/M |
| 3300018065|Ga0180430_11210319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 531 | Open in IMG/M |
| 3300018065|Ga0180430_11267507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 517 | Open in IMG/M |
| 3300018080|Ga0180433_10376017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1102 | Open in IMG/M |
| 3300021511|Ga0190284_1015329 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300022391|Ga0210374_1131555 | Not Available | 536 | Open in IMG/M |
| 3300022552|Ga0212118_10309678 | Not Available | 871 | Open in IMG/M |
| (restricted) 3300022912|Ga0233430_1237903 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10023748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1385 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10139270 | Not Available | 586 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10150063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfotignum | 566 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10160532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 548 | Open in IMG/M |
| (restricted) 3300023085|Ga0233406_10037218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 677 | Open in IMG/M |
| (restricted) 3300023085|Ga0233406_10040145 | Not Available | 662 | Open in IMG/M |
| (restricted) 3300023085|Ga0233406_10040850 | Not Available | 658 | Open in IMG/M |
| (restricted) 3300023085|Ga0233406_10084473 | Not Available | 530 | Open in IMG/M |
| (restricted) 3300023085|Ga0233406_10100562 | Not Available | 504 | Open in IMG/M |
| (restricted) 3300023086|Ga0233407_10023695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 775 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10075147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1068 | Open in IMG/M |
| (restricted) 3300023114|Ga0233405_10067120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 598 | Open in IMG/M |
| (restricted) 3300023114|Ga0233405_10072945 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| (restricted) 3300023114|Ga0233405_10085685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 552 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10030520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2158 | Open in IMG/M |
| (restricted) 3300023271|Ga0233403_10185283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 609 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10332569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 638 | Open in IMG/M |
| (restricted) 3300024259|Ga0233437_1395480 | Not Available | 504 | Open in IMG/M |
| 3300024265|Ga0209976_10763712 | Not Available | 503 | Open in IMG/M |
| (restricted) 3300024338|Ga0255043_10048828 | Not Available | 1291 | Open in IMG/M |
| (restricted) 3300024338|Ga0255043_10254418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10095443 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10239264 | Not Available | 835 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10223857 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| (restricted) 3300024529|Ga0255044_10228149 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-1 | 742 | Open in IMG/M |
| (restricted) 3300024529|Ga0255044_10402530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300025814|Ga0210101_1043345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1211 | Open in IMG/M |
| 3300026968|Ga0207831_100016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 461429 | Open in IMG/M |
| 3300026968|Ga0207831_100023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 385056 | Open in IMG/M |
| 3300026968|Ga0207831_100060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 183421 | Open in IMG/M |
| 3300026975|Ga0207799_100010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 388766 | Open in IMG/M |
| 3300026975|Ga0207799_100108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 98512 | Open in IMG/M |
| 3300026975|Ga0207799_100423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 16870 | Open in IMG/M |
| 3300027021|Ga0207721_113179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 767 | Open in IMG/M |
| 3300027758|Ga0209379_10095142 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300027820|Ga0209578_10077691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1660 | Open in IMG/M |
| 3300027828|Ga0209692_10410713 | Not Available | 577 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10294472 | Not Available | 586 | Open in IMG/M |
| 3300027845|Ga0209271_10013131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3295 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10182393 | Not Available | 1032 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10056985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1648 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10099444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1279 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10658389 | All Organisms → cellular organisms → Bacteria → Aquificae → unclassified Aquificae → Aquificae bacterium | 512 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10041948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2186 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10220852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 913 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10300016 | Not Available | 775 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10381581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 682 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10382936 | Not Available | 680 | Open in IMG/M |
| 3300027978|Ga0209165_10003746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 5127 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10034579 | Not Available | 1917 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10063479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1443 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10103275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1150 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10279178 | Not Available | 715 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10326583 | Not Available | 663 | Open in IMG/M |
| 3300028026|Ga0256846_1015167 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300028026|Ga0256846_1036252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1084 | Open in IMG/M |
| 3300028026|Ga0256846_1036769 | Not Available | 1078 | Open in IMG/M |
| 3300028026|Ga0256846_1084164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 775 | Open in IMG/M |
| 3300028026|Ga0256846_1116102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 679 | Open in IMG/M |
| 3300028026|Ga0256846_1138801 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300028029|Ga0256845_1078041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1201 | Open in IMG/M |
| 3300028029|Ga0256845_1089464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1096 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10061633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 1563 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10194900 | Not Available | 908 | Open in IMG/M |
| 3300028195|Ga0257125_1056792 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300031276|Ga0307441_1225847 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 533 | Open in IMG/M |
| 3300031727|Ga0316576_11198389 | Not Available | 536 | Open in IMG/M |
| 3300032137|Ga0316585_10043777 | Not Available | 1430 | Open in IMG/M |
| 3300032231|Ga0316187_10051047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3304 | Open in IMG/M |
| 3300032231|Ga0316187_10069330 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
| 3300032231|Ga0316187_10285280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1261 | Open in IMG/M |
| 3300032231|Ga0316187_10411922 | Not Available | 1020 | Open in IMG/M |
| 3300032251|Ga0316198_10000004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 86778 | Open in IMG/M |
| 3300032251|Ga0316198_10005174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 8041 | Open in IMG/M |
| 3300032251|Ga0316198_10011838 | All Organisms → cellular organisms → Bacteria | 5419 | Open in IMG/M |
| 3300032251|Ga0316198_10028952 | Not Available | 3390 | Open in IMG/M |
| 3300032252|Ga0316196_10099504 | Not Available | 1350 | Open in IMG/M |
| 3300032258|Ga0316191_10010972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp. BuS5 | 6885 | Open in IMG/M |
| 3300032262|Ga0316194_10139736 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300032272|Ga0316189_10042230 | All Organisms → cellular organisms → Bacteria | 3953 | Open in IMG/M |
| 3300032272|Ga0316189_10314188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1220 | Open in IMG/M |
| 3300032272|Ga0316189_10502867 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300032272|Ga0316189_10894163 | Not Available | 674 | Open in IMG/M |
| 3300032272|Ga0316189_10926250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 661 | Open in IMG/M |
| 3300032272|Ga0316189_11119621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 595 | Open in IMG/M |
| 3300032273|Ga0316197_10064345 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Aureliella → Aureliella helgolandensis | 2351 | Open in IMG/M |
| 3300033429|Ga0316193_10196046 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1597 | Open in IMG/M |
| 3300033429|Ga0316193_11238922 | Not Available | 592 | Open in IMG/M |
| 3300033429|Ga0316193_11322857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 572 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 20.57% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 16.27% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 8.61% |
| Aerobic Enrichment Media | Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media | 7.66% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 5.26% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 5.26% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 5.26% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 4.31% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.31% |
| Tube Worm Surface | Host-Associated → Annelida → Integument → Unclassified → Unclassified → Tube Worm Surface | 3.83% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 2.39% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.91% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.44% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.96% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.48% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.48% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.48% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.48% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.48% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.48% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.48% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.48% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.48% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.48% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.48% |
| Marine Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment | 0.48% |
| Deep-Sea Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent | 0.48% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 0.48% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.48% |
| Marine Gutless Worms Symbiont | Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont | 0.48% |
| Marine Gutless Worms Symbiont | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont | 0.48% |
| Marine Gutless Worms | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000872 | Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M2 | Engineered | Open in IMG/M |
| 3300000920 | Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M1 (2) | Engineered | Open in IMG/M |
| 3300001685 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 | Environmental | Open in IMG/M |
| 3300002052 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
| 3300003142 | Marine sediment microbial communities from deep subseafloor - Sample from 5.1 mbsf | Environmental | Open in IMG/M |
| 3300003777 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius filocauda PIANOSA.2 | Host-Associated | Open in IMG/M |
| 3300003817 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND | Host-Associated | Open in IMG/M |
| 3300004109 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_150m_DNA | Environmental | Open in IMG/M |
| 3300004212 | Groundwater microbial communities from aquifer - Crystal Geyser CG02_land_8/20/14_3.00 | Environmental | Open in IMG/M |
| 3300004974 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_200m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005753 | Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assembly | Environmental | Open in IMG/M |
| 3300005917 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKH | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300005932 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKG | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
| 3300009138 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG | Environmental | Open in IMG/M |
| 3300009145 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG | Environmental | Open in IMG/M |
| 3300009374 | Combined Assembly of Gp0137041, Gp0137043 | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300009788 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG | Environmental | Open in IMG/M |
| 3300009941 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 7, 12m depth; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010298 | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG | Host-Associated | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013103 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013117 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 900m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300014914 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm | Environmental | Open in IMG/M |
| 3300017960 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaG | Environmental | Open in IMG/M |
| 3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
| 3300017992 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaG | Environmental | Open in IMG/M |
| 3300018065 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300021511 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-1-2_MG | Environmental | Open in IMG/M |
| 3300022391 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022552 | Guaymas_combined assembly | Environmental | Open in IMG/M |
| 3300022912 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_150_MG | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300023085 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MG | Environmental | Open in IMG/M |
| 3300023086 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_7_MG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023114 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_3_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023271 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_1_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300024265 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024338 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025814 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026968 | Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M1 (2) (SPAdes) | Engineered | Open in IMG/M |
| 3300026975 | Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M2 (SPAdes) | Engineered | Open in IMG/M |
| 3300027021 | Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and P2 (1) (SPAdes) | Engineered | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028026 | Tube worm associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - Tevnia | Host-Associated | Open in IMG/M |
| 3300028029 | Tube worm associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - Riftia | Host-Associated | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028195 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_200 | Environmental | Open in IMG/M |
| 3300031276 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-20 | Environmental | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Host-Associated | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300032273 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxic | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBA_SWE12_21mDRAFT_101743001 | 3300000124 | Marine | MLASVHLEMVDFGFRQGPSEFSTAGIARYFEDWKRERTPPGAERCR |
| JGI12365J12839_10007003 | 3300000872 | Aerobic Enrichment Media | MVDFGSEQGLSDFETAGIVDYFEDFKRAKTPLGAKRCHLWMDTK* |
| JGI12365J12839_10010851 | 3300000872 | Aerobic Enrichment Media | MVDFGSEQGLSDFSRDGTSRLIYSLRWVETAGIVDYFEDFKRAKTPLGAKDAF |
| JGI12573J12842_100012648 | 3300000920 | Aerobic Enrichment Media | MVDFGFEQGLSDLETAGIVDYFEDFQRAKTPLGAKRCRL* |
| JGI12573J12842_10001652 | 3300000920 | Aerobic Enrichment Media | MVDFGSEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI* |
| JGI12573J12842_10002331 | 3300000920 | Aerobic Enrichment Media | MVDFGSEQGLSDFETAGIVNYFEDFKRAKTPLGAKRCH |
| JGI12573J12842_100034814 | 3300000920 | Aerobic Enrichment Media | MVDFGFEQGLSNLETAGIVDYFEDFQRAKTPLGAKRCRLWMGTI* |
| JGI12573J12842_10005631 | 3300000920 | Aerobic Enrichment Media | MVDFGFEQGLSDFETAGIVDYFEDFKRAKTPLGAKRC |
| JGI12573J12842_10007081 | 3300000920 | Aerobic Enrichment Media | MVDFGFEQGLGDFETAGIVDYFEDFKRAKTPLGAKRCHLW |
| JGI12573J12842_10038531 | 3300000920 | Aerobic Enrichment Media | VDFGSEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI* |
| JGI24024J18818_100060191 | 3300001685 | Marine | SVRPQMVDFGSRQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMDTN* |
| JGI24024J18818_101380901 | 3300001685 | Marine | MVDFGSGQGLSDFETGGITCYFEDFKRAKTPLRAERCRLWIVTNPLRAIE |
| SMTZ1_1003085911 | 3300002052 | Marine Sediment | MVDFGFRQGPSEFSTAGIARYFEDWKRARTPPGAEICRLWMDNS* |
| Ga0052242_10232842 | 3300003142 | Marine Sediment | MIDFGSGQGLSDFETGGIACYFEDFKREKTPPRVERCRLWMETK* |
| Ga0049110_100633892 | 3300003777 | Marine Gutless Worms Symbiont | VSVHPEMIDFGSEQGLSDFETVGIVRYFEDFKRAKTPLWAKRCRLWMGTI* |
| Ga0056122_100371212 | 3300003817 | Marine Gutless Worms Symbiont | MVDFGSERGLSDFETAGIVSYSEDFKRAKTLLWSQPVDA* |
| Ga0008650_10587832 | 3300004109 | Marine | IVDFGSEQGLSNFETGGIARHFEDFIIAKTQLRAKRCCLWLDTT* |
| Ga0066631_100917802 | 3300004212 | Groundwater | MVDFGSERGLSVFEAAGITCYFEDFKKAKTKLWAKRRRLWMDTNYQEPAVHRFQQV* |
| Ga0066617_12747123 | 3300004974 | Marine | MIDFGSGQGLNIFATAGIARYFEDCKKVKTPAWAKRCRFWM |
| Ga0070728_1000799211 | 3300005588 | Marine Sediment | MVDFGSGQGLSDFETGGMACYFEDFKRAKTPPGAERCRLWMDNRKELT* |
| Ga0070726_1000338912 | 3300005600 | Marine Sediment | MVDFGSGQGLSDFETGGMACYFEDFKRAKTPPGAERYRLWMDNRKELT* |
| Ga0077776_10234121 | 3300005753 | Deep-Sea Hydrothermal Vent | DFGSEQGLSNFETGGIAVGYVEDFKIAKTPLWAKRCCL* |
| Ga0075115_101248932 | 3300005917 | Saline Lake | MVDFGSEQGLSDFETDSVAVIVSTGIARYFEDFKKAKTKLWAKRCRFWIGTSHVKSRKMCT* |
| Ga0075115_102890022 | 3300005917 | Saline Lake | MVGFGSEQGLSDFETTGIACYFEDFKRAKTKLRAKRCRLWM |
| Ga0070725_104405901 | 3300005920 | Marine Sediment | MVDFGPEQGLSDFETDGEAVTATAGVAGYVEDLKRAKTPLRAKRCRLWMGT |
| Ga0075121_10402531 | 3300005932 | Saline Lake | SVHPEMVDFGSEQGLSDFKTAGIARYFEDFKRAKTKLWAKRCRLWMCTSYTI* |
| Ga0075121_10702451 | 3300005932 | Saline Lake | EMVDFGSEQGLSDFESAGIACYFEDFKRAKTKLWAKRCRLWMDTKIKNFQERR* |
| Ga0075121_11798492 | 3300005932 | Saline Lake | MVDFGSEQGLSDFETAGIACYFEDFKKAKTKLRAKRCRFWMGTK* |
| Ga0099972_110256991 | 3300006467 | Marine | MVAFGSEQGLSNFETAGIVHYSEDFKGAKTQLWAKRCHFWMG |
| Ga0102958_13213752 | 3300009035 | Soil | MVAFGSEQGLSDFKTAGIVRYFEDFKKAKTPLWAKRCRL* |
| Ga0102959_12152131 | 3300009138 | Soil | MVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCRLWMGTR* |
| Ga0102961_11438262 | 3300009145 | Soil | MVGFGSERGLNDFETAGIARYSEDLKIVKTLLWAERCRLWMDAKENPQ* |
| Ga0118720_10225473 | 3300009374 | Marine | MVDFGSEQGLSAFETAGIVNYFEDFKRAKTPLRAERCRLWTGTN* |
| Ga0118657_119778011 | 3300009506 | Mangrove Sediment | MADFGSGQGLNDFETGGIACYFEDFKRAKTPPRVER |
| Ga0123573_102400292 | 3300009509 | Mangrove Sediment | MVDFGSEQGLSDFETAGIVSYFEDYKRAKTPLGVKRCHFWMGTN* |
| Ga0114923_100699793 | 3300009788 | Deep Subsurface | MVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAKRCRLWMGTI* |
| Ga0114923_103440292 | 3300009788 | Deep Subsurface | MDRNITSVRPQMVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAKRCRLWMGTN* |
| Ga0114923_107459682 | 3300009788 | Deep Subsurface | MVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAKR |
| Ga0114923_109347001 | 3300009788 | Deep Subsurface | RPFFNTNILLTSVLPQMVDFGSEQGLSNFETAGIAGYVEDFKRTKTPLWAKRCRLWMDTKIH* |
| Ga0114923_111377551 | 3300009788 | Deep Subsurface | NLVSVRPQMVDFGSEQGLSNFETDGVAVPALAGIAGYIEDFKRAKTPLRAKRCRLWMDTS |
| Ga0114923_111386722 | 3300009788 | Deep Subsurface | VDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAKRCRLWMGTI* |
| Ga0114923_112860181 | 3300009788 | Deep Subsurface | MVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAK |
| Ga0114923_113461921 | 3300009788 | Deep Subsurface | VDFGSEQGLSNFETAGIAGYVEDFKRAKTPLRAKRCRLWMDTNWFDFGIDKYFI* |
| Ga0132240_10551642 | 3300009941 | Meromictic Pond | MVDFGSERGLSVFETTGIAGYFEDFKKAKTKCWAKRCHL |
| Ga0126325_1000004130 | 3300010298 | Marine Gutless Worms | MVVFGLEQGLSDLETAGIAGYSEDFKVAKTPLWAKRCRLWMGTN* |
| Ga0136651_102814641 | 3300010330 | Marine Hydrothermal Vent | VDFGSQQGLSDFETTGIVGYVEDFKRAKTQLRAKRCCLWMDTN* |
| Ga0136651_102816862 | 3300010330 | Marine Hydrothermal Vent | MVDFGLQQGLSDFETTGIVSYVEDFRRAKTPLRAQRCRLWMDIT* |
| Ga0118731_1009468791 | 3300010392 | Marine | MVDFGSRQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMEPTKLLVVLC* |
| Ga0118731_1078514122 | 3300010392 | Marine | MVDFGSEQGLSYFEIDGEAVPALAGIAGYFEDFKRAKTPLRAKRCRLWMGTN* |
| Ga0118731_1120982022 | 3300010392 | Marine | MVDFGSEQGLSDFETGGIAGYVEDFKRAKTPLWAKRCRLWTDTI* |
| Ga0118733_1005984373 | 3300010430 | Marine Sediment | MVDFGPEQGLSDFETGGVVGYVEDLKRVKTPLRAKRCRLWLDTN* |
| Ga0118733_1067975971 | 3300010430 | Marine Sediment | MVDFGSEQGLSDFESTGIAGYFEEFKRAKTPLWAKRCRLWMGTIEEKSI* |
| Ga0118733_1074666871 | 3300010430 | Marine Sediment | MVDFGSGQGLSDFETGGIALYFEDFKRSKTPPRAERCCLWMDTEPGLTGP* |
| Ga0164320_101284991 | 3300013098 | Marine Sediment | MVDIGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWM |
| Ga0164320_101295482 | 3300013098 | Marine Sediment | DSVRPQMVDFGSEQGLSNFETADIAGYVEDFKRAKTPLWAKRCRLWMDTG* |
| Ga0164320_101578721 | 3300013098 | Marine Sediment | VRPQMVDLGSEQGLSNFETAGIAGYVEDLKRAKTPLWAKRCRLRMDTN* |
| Ga0164320_102226322 | 3300013098 | Marine Sediment | LSGLKEKAVVYILRNSVRPQMVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWMGTK* |
| Ga0164320_102875501 | 3300013098 | Marine Sediment | VDIGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWMDTN* |
| Ga0164320_104776101 | 3300013098 | Marine Sediment | STQKFGFFSNLVSVRPQRVDFGSEQGLSNFETGGIAGYVEDFKRAKTPLWGKRCRLWMDTN* |
| Ga0164320_105122041 | 3300013098 | Marine Sediment | MVSVRPQMVDVGSEQGLSNFETAGIAGYFEDFKRAKTPLWAKRCRLWMGTN* |
| Ga0164320_106282271 | 3300013098 | Marine Sediment | DFGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWMGTS* |
| Ga0164320_107758251 | 3300013098 | Marine Sediment | FGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWMGTI* |
| Ga0164320_107920461 | 3300013098 | Marine Sediment | SNFETAGIAGYVEDFKRAKTPLWAKRCCLWMGTN* |
| Ga0164315_101555661 | 3300013099 | Marine Sediment | DFGSEQGLSDFETAGIASYSEDFKRAKTPLRAERCRLWMGTK* |
| Ga0164315_102196682 | 3300013099 | Marine Sediment | MVDFGSEQGLIDFETASIAGYSEGFKRAKTPLRAKR |
| Ga0164315_103622502 | 3300013099 | Marine Sediment | MVDFGSEQGLSDFETNGVAVSAIAGIVGYVEDFKR |
| Ga0164315_104041231 | 3300013099 | Marine Sediment | IIIKNSVRPQMVDFGSKQGLSDFETAGIASYVEDFKRAKTPLRAKRCRLWMGTTSQG* |
| Ga0164315_104135391 | 3300013099 | Marine Sediment | EQGLSDFETAGIARYSEEFKRAKTPLWAKRCRLWMGTI* |
| Ga0164315_104201722 | 3300013099 | Marine Sediment | VRPQMVDFGSEQGLSDFETAGIVGYVEDFKRAKTPLRAKRCRLWMDTR* |
| Ga0164315_104371891 | 3300013099 | Marine Sediment | FGSEQGLSDFESAVIASYFEEFKRAKTPLWAKRCRLWMDTLGDYKDHTGL* |
| Ga0164315_105181691 | 3300013099 | Marine Sediment | EQGLSSFETAGIAGYVEDFKKAKTPLWAKRCRLWMGTK* |
| Ga0164315_106306982 | 3300013099 | Marine Sediment | DFGSEQGLSYFETAGIAGYVEEFKRAKTPLWDKRCRLWMGTKYKG* |
| Ga0164315_107157592 | 3300013099 | Marine Sediment | MVDFGSEQGLSDFETAGIAGYSEEFKRAKTPHWIKRCRLWTGTI* |
| Ga0164315_109457312 | 3300013099 | Marine Sediment | DFGSEQGLSYFETAGIAGYVEEFKRAKTPLWDKRCRLWMDTNSLL* |
| Ga0164315_109870152 | 3300013099 | Marine Sediment | MVDFGSEQGLSYFETAGIAGYVEEFKIAKTPPWAKRCRLWMGAI* |
| Ga0164315_110888781 | 3300013099 | Marine Sediment | QDSVRPEMVDFGSGQGLNVFETAGIAGYSEEFKKVKTQPWAERCRLWMGTS* |
| Ga0164315_112610162 | 3300013099 | Marine Sediment | MVDFGSEQGLSDFETAGIVRYSEDFRRAKTPLWAKRCRLWMGTSYKNTPPSIGKVRGTS* |
| Ga0164315_112961851 | 3300013099 | Marine Sediment | MVDFGLQQGLSDFETTSIVSYVEDFRRAKTPLRAQRCRLWMDIT* |
| Ga0164315_115105001 | 3300013099 | Marine Sediment | GLSYFETAGIAGYVEEFKRAKTPLWDKRCRLWMGTH* |
| Ga0164315_116081521 | 3300013099 | Marine Sediment | MVDFGSEQGLSYFETAGIAGYVEDFKRAKTPLWAKKCRLWMG* |
| Ga0164313_101878562 | 3300013101 | Marine Sediment | MVDFGSEQGLSDFETAGIARYSEEFKRAKTPLWAKRCRLWMGTS* |
| Ga0164313_103546422 | 3300013101 | Marine Sediment | MVDFGSEQGLSYFETAGIAGYVEDFKIAKTPLWAKRCRLWMGTI* |
| Ga0164313_104030132 | 3300013101 | Marine Sediment | MVDFGSGQGLNVFETAGIAGYSEEFKKVKTQPWAERCRLWMGTMLILGLFFT |
| Ga0164313_105344352 | 3300013101 | Marine Sediment | MTQANSVRPQMVDFGSEQGLSSFETAGIAGYVEDFKKAKTPLWAKRCRLWMGTK* |
| Ga0164313_105574912 | 3300013101 | Marine Sediment | MVDFGSEQGLSDFETNGVAVSAIAGIVGYVEDFKRAKTPLWAKRCRLWMGTN* |
| Ga0164313_106257041 | 3300013101 | Marine Sediment | VSVRPEMVDFGSEQGLSDFETAGIAGYSEEFKRAKTPLWAKRCRLWMSTS* |
| Ga0164313_110148081 | 3300013101 | Marine Sediment | MVDFGSEQGLSDFETAGIASYSEDFKRAKTPLRAERCRLWMGTK* |
| Ga0164313_110295453 | 3300013101 | Marine Sediment | MVDFGSEQGLSDFETAGIARYVEEFKRAKTPLWAKRCRLWMGT |
| Ga0164313_114709572 | 3300013101 | Marine Sediment | VRPQMVDFGSEQGLSYFETAGIAGYVEDFKRAKTPLWAKKCRLWMG* |
| Ga0164313_115188611 | 3300013101 | Marine Sediment | MVGFGSRQGLNVFETAGIAGYSEDFKKVKTQPWAKRCRLWM |
| Ga0164313_117178201 | 3300013101 | Marine Sediment | EMVDFGSEQGLSDFETAGIAGYSEDFKRAKTPLWAKRCRLWMGTS* |
| Ga0164318_114529431 | 3300013103 | Marine Sediment | MVDFGSEQGLSDFETAGIARYVEEFKRAKTPLWDKRCRLWMGTH* |
| Ga0171658_10512222 | 3300013117 | Marine | DFFNHFIVGVSPQMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAGRCRLWIDTN* |
| Ga0164321_100099032 | 3300014903 | Marine Sediment | MVLYQNIFLLLTSVHPQMIDFGSGQGLSDFETGGIACYFEDFKREKTPPRGERCRLWAGTN* |
| Ga0164321_106754131 | 3300014903 | Marine Sediment | MVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRL |
| Ga0164311_106115331 | 3300014914 | Marine Sediment | MVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCRLWMGTK* |
| Ga0164311_106759371 | 3300014914 | Marine Sediment | MTQANSVRPQMVDFGSKQGLSSFETAGIAGYVEDFKKAKTPLWAKRCRLWMGTK* |
| Ga0180429_105299731 | 3300017960 | Hypersaline Lake Sediment | FGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCRLWMGTR |
| Ga0180429_108336483 | 3300017960 | Hypersaline Lake Sediment | MVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCRLWMGT |
| Ga0180429_109640382 | 3300017960 | Hypersaline Lake Sediment | PEMVDFGSEQGLSDFETAGIARYFEDFKRAKTPLWAKRCRLWMDTK |
| Ga0180429_110128482 | 3300017960 | Hypersaline Lake Sediment | FGSEQGLSNLEAGVIARYFEDLQRAKTQLWADGTPRAL |
| Ga0180436_110567331 | 3300017990 | Hypersaline Lake Sediment | MDFLIVQGLTSVRPEMVGFGSEQGMSDFEIGVITGYFEDFKRVKTPLWAKRCRLWTGNRG |
| Ga0180435_105003131 | 3300017992 | Hypersaline Lake Sediment | MADFGSGQGLSDLETGGIARYFEGFQRAKTPLWAKRCRLWVGN |
| Ga0180435_107450381 | 3300017992 | Hypersaline Lake Sediment | MVDFDSEQGLSDFETAGIARYFEDFIRVKTPLWIKKCRLWMGNP |
| Ga0180435_109018892 | 3300017992 | Hypersaline Lake Sediment | SVRPEMVDFGSEQGLSDFETAGIAGYSEAFKRAKTPLWAKRCRLFCL |
| Ga0180435_114653382 | 3300017992 | Hypersaline Lake Sediment | MVDFGFGQGLSDIETAGIVGYFEDFKRAKTPLGTKRCRLLMGTNE |
| Ga0180435_114736691 | 3300017992 | Hypersaline Lake Sediment | MVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCR |
| Ga0180430_104298332 | 3300018065 | Hypersaline Lake Sediment | MVNFGSGQGLNDLEAGEIAGYFEDFQRAKTQPWAERCRLWMDTIYETALGIA |
| Ga0180430_105370993 | 3300018065 | Hypersaline Lake Sediment | MVGFGSEQGLSDFEPAGIVRYFEELKRAKTPLWAKRCHLLMGTY |
| Ga0180430_109653992 | 3300018065 | Hypersaline Lake Sediment | MVDFGSEQGLSDFETTGIARYFEDLKIAKTPLWAKRCRLWMDTNRCVQLFHPKTGC |
| Ga0180430_110759812 | 3300018065 | Hypersaline Lake Sediment | MVDFGSEQGLSDFETAGIARYSEEFKKAKTPLWAERCRLWMGTI |
| Ga0180430_112096602 | 3300018065 | Hypersaline Lake Sediment | MVDFGSEQGLSDFESAGIVHYFEEFKRAKTPLWAKRCRLWADTIWRAS |
| Ga0180430_112103192 | 3300018065 | Hypersaline Lake Sediment | MVDFGSEQGLSDFETGVITGYFEDFKRAKTPLWTVICHLWMGTE |
| Ga0180430_112675072 | 3300018065 | Hypersaline Lake Sediment | MVDFGSEQGLSDFETAGIARYFEDFKRAKTPLWAKRCRLWMDTK |
| Ga0180433_103760172 | 3300018080 | Hypersaline Lake Sediment | MVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAERCRLWMGTN |
| Ga0190284_10153292 | 3300021511 | Hydrothermal Vent Microbial Mat | MVDFGLQQGLSDFETTGIVSYVEDFKRAKTPLRAKRCRLWMDIT |
| Ga0210374_11315551 | 3300022391 | Estuarine | MVDFGSGQGLSDFETGGIACYFEDFKRAKTPPGAERCRLWMEN |
| Ga0212118_103096782 | 3300022552 | Marine Hydrothermal Vent | YLSCLSDSVLPQMVDFGLQQGLSDFETTGIVGYVEDFKRAKTQLRAKRCCLWMDTN |
| (restricted) Ga0233430_12379031 | 3300022912 | Seawater | GSGQGINDFETTGIAGYFEDFKKVKTPPWAERCRLRTRTKKR |
| (restricted) Ga0233404_100237481 | 3300022913 | Seawater | MVDFGSKQGLSDFESAVIARYFEEFKRAKTPLWAKRCHLWMGTLGDYKDHTGP |
| (restricted) Ga0233404_101392701 | 3300022913 | Seawater | TYYTGVHPQMVDFGSEQGLSDSETGGIARYSEDLKIVKTPLWAKRCRLWVDTN |
| (restricted) Ga0233404_101500633 | 3300022913 | Seawater | MVDFGSEQGLSDFETAGIAGYVEDFKRAKTPLWAKRCHLW |
| (restricted) Ga0233404_101605321 | 3300022913 | Seawater | FGSEQGLSNFETAGIAGYSEDFKRAKTPLWAERCRLWMGTK |
| (restricted) Ga0233406_100372182 | 3300023085 | Seawater | MLYLFSVHPQMVDFGSGQGLSDFETAGIAGYSEDFKRAKTPLWAERCRLWMGTK |
| (restricted) Ga0233406_100401451 | 3300023085 | Seawater | LIFTAAPLVCVCPQVVAFDSEQGLSDFETAGIVRYIEESKIAKTPLCAKRCRLWMDTI |
| (restricted) Ga0233406_100408501 | 3300023085 | Seawater | MVDFGSEQGLSDFETAGIARYSEDLKIAKTPLWAKRCRLWM |
| (restricted) Ga0233406_100844731 | 3300023085 | Seawater | MVDFGSEQGLSDFETAVIAGYVEEFKRAKTPLWAKRGR |
| (restricted) Ga0233406_101005622 | 3300023085 | Seawater | MVDFGSEQGLSDFETAGTADYVEEFKRAKTPLRAKRCRLWMGTSVCPQMVDFGSEQGLSDFE |
| (restricted) Ga0233407_100236952 | 3300023086 | Seawater | MSGSLASVHPQMVDFGSEQGLSYFETGGIAVYVADFKRAKTPPWAKRCRL |
| (restricted) Ga0233411_100751472 | 3300023112 | Seawater | MVDFGSEQGLSDFETAGIARYSEDFKRAKTLLWAERCRLWMGTI |
| (restricted) Ga0233405_100671202 | 3300023114 | Seawater | DFGSKQGLSDFESAVIARYFEEFKRAKTPLWAKRCHLWMGTLGDYKDHTGP |
| (restricted) Ga0233405_100729452 | 3300023114 | Seawater | MHIRSPIFSELFSVRPQIVDFGSEQGLSNFETAGIASYVEDFKRAKTPLWAERCCLWMDT |
| (restricted) Ga0233405_100856852 | 3300023114 | Seawater | LTSVHPEMVDFGSEQGLSDFETAGIASYSEDFERAKTQL |
| (restricted) Ga0233412_100305204 | 3300023210 | Seawater | MVDFGSEQGLSDFESAGIVRYFEEFKRAKTPLWAKRCRLWMGII |
| (restricted) Ga0233403_101852831 | 3300023271 | Seawater | VGFGLGQGLNVFETGGIVGYSEDFKKVKTQPWAKRCPLWRDTI |
| (restricted) Ga0255040_103325691 | 3300024059 | Seawater | VDFGPEQGLSDFETGGVAGYVEDFKRAKTPLRAKRCRLGMDT |
| (restricted) Ga0233437_13954801 | 3300024259 | Seawater | MVDFGSEQGLSNFETAGIAGYVEDFKRAKTPLWAKRCRLWMGTN |
| Ga0209976_107637122 | 3300024265 | Deep Subsurface | MVDFGSEQGLSNFETDGVAVPALAGIAGYIEDFKRAKTPLRAKRCRLWMDTS |
| (restricted) Ga0255043_100488281 | 3300024338 | Seawater | MIDFGSGQGLSDFETGGIACYFEDFKREKTPPRAERCRLWMETK |
| (restricted) Ga0255043_102544181 | 3300024338 | Seawater | MIDFGSGQGLNDFETGGIACYFEDFEREKTPPRAERCRLWMGTG |
| (restricted) Ga0255046_100954432 | 3300024519 | Seawater | MKIFLFSVRPQMTDFGSRQGLSDFETGGIACYFEDFKREKTLPRAERCRLWMGTI |
| (restricted) Ga0255046_102392642 | 3300024519 | Seawater | NFAIVRSQMIDFGSGQGLSDFETGGIACYFEDFKREKTPPRVERCRLWMETK |
| (restricted) Ga0255045_102238572 | 3300024528 | Seawater | SAHPEMVNFGSGQGLSDFETGGIACYFEDFKRAKTLPRAERCLL |
| (restricted) Ga0255044_102281492 | 3300024529 | Seawater | MVDFGSGQGLSDFETGGIACYFEDFKIAKTPPRGERCRLWM |
| (restricted) Ga0255044_104025301 | 3300024529 | Seawater | PEMVNFGSGQGLGDFETGGIACYFEDFKRAKTLPRAERCLL |
| Ga0210101_10433452 | 3300025814 | Natural And Restored Wetlands | MVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAER |
| Ga0207831_100016295 | 3300026968 | Aerobic Enrichment Media | MVDFGFEQGLGDFETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI |
| Ga0207831_100023301 | 3300026968 | Aerobic Enrichment Media | MVDFGFEQGLSNLETAGIVDYFEDFQRAKTPLGAKRCRLWMGTI |
| Ga0207831_10006066 | 3300026968 | Aerobic Enrichment Media | MVDFGSEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI |
| Ga0207799_100010154 | 3300026975 | Aerobic Enrichment Media | MVDFGSEQGLSDFETAGIVDYFEDFKRAKTPLGAKRCHLWMDTK |
| Ga0207799_10010841 | 3300026975 | Aerobic Enrichment Media | MYGSPLTSARPEMVDFGFGQGLSDFETAGIVGYFEDFKRAKTPLGSKRCRL |
| Ga0207799_10042315 | 3300026975 | Aerobic Enrichment Media | MVDFGFEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCRF |
| Ga0207721_1131792 | 3300027021 | Aerobic Enrichment Media | MVDFGSEQGLSDFETAGIVDYFEDFKRAKTPLGTKRCHLWMDTT |
| Ga0209379_100951422 | 3300027758 | Marine Sediment | MVDFGSGQGLSDFETGGMACYFEDFKRAKTPPGAERCRLWMDNRKELT |
| Ga0209578_100776911 | 3300027820 | Marine Sediment | MVDFVSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMDTN |
| Ga0209692_104107131 | 3300027828 | Marine Sediment | QIVDFGSGQGLSDFETGGIACYFEDFKRTKTPPRVERCRN |
| (restricted) Ga0255041_102944722 | 3300027837 | Seawater | MVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMDT |
| Ga0209271_100131311 | 3300027845 | Marine Sediment | MVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWM |
| (restricted) Ga0255054_101823931 | 3300027856 | Seawater | MVGFGSEQGLSNFETGGVAGYVEDLKRAKTPLLAKRCRLWM |
| (restricted) Ga0233415_100569852 | 3300027861 | Seawater | MVDFASEQGLSAFETTGIAGYVEDFKRAKTPLWAKRCRLWVGTNQAMEVS |
| (restricted) Ga0233415_100994441 | 3300027861 | Seawater | SVHPEMVDFGSEQGLSDFETAGIARYSEDFERAKTQLRA |
| (restricted) Ga0233415_106583892 | 3300027861 | Seawater | KNKLPIVHPEMVDFGSEQGLSDFETAGIACYFEDFKRAKTPLWAKRCRFWTDTH |
| (restricted) Ga0255053_100419482 | 3300027868 | Seawater | MIDFGSGQGLSDFETGGIACYFEDFKREKTPPRVERCRLWMETK |
| (restricted) Ga0255053_102208521 | 3300027868 | Seawater | MVDFGSEQGLSNFETGGVAGYVEDFKRAKTPLRTKRCRLWMG |
| (restricted) Ga0255053_103000162 | 3300027868 | Seawater | YPALPRVTLVSVRPQMVDFGSEQGLSNFETGGVAGYVEDFKRAKTPLRAKRCRLWMDTS |
| (restricted) Ga0255053_103815813 | 3300027868 | Seawater | VSVRPQMVGFGSEQGLSNFETGGVAGYVEDLKRAKTPLWAKRYRLWMGTS |
| (restricted) Ga0255053_103829361 | 3300027868 | Seawater | EANPPLIVSVRPQMVDFGSEQGLSNFETGGVAGYVEDFKRAKTPLRGKRCRLWIGTS |
| Ga0209165_100037461 | 3300027978 | Marine Sediment | MVDFVSGQGLSDFETGGIACYFEDFKRAKTPPRAERC |
| (restricted) Ga0233413_100345791 | 3300027996 | Seawater | GSEQGLSDFETAGIARYSEDFKRAKTLLWAERCRLWMGTI |
| (restricted) Ga0233413_100634791 | 3300027996 | Seawater | MVDFGSEQGLSDFESAVIARYFEEFKRAKTPLWAKRCHLWMGTLGDYKDHTGP |
| (restricted) Ga0233413_101032751 | 3300027996 | Seawater | DFGSEQGLSDFETAGIARYSEDFKRAKTPLWAKRCRLWMGTR |
| (restricted) Ga0233413_102791782 | 3300027996 | Seawater | GSEQGLSDFESAGIVHYFEEFKRAKTPLWAKRCRLWMGII |
| (restricted) Ga0233413_103265831 | 3300027996 | Seawater | MVGFGSGQGLNVFETAGIAGYSEDFKKVKTQPWAKKCRLWMGTI |
| Ga0256846_10151672 | 3300028026 | Tube Worm Surface | MVDFGSGQGLSDFETAGIAGYVEDFKRAKTQPWAKRCRLWMDTS |
| Ga0256846_10362521 | 3300028026 | Tube Worm Surface | FGSGQGLSDFETAGIAGYFEDFKRAKTQPWAKRCRLWMGTSYI |
| Ga0256846_10367691 | 3300028026 | Tube Worm Surface | GSGQGLSDFETAGIAGYSEDFKRAKTPPWAERCRLWMGTNL |
| Ga0256846_10841641 | 3300028026 | Tube Worm Surface | MVDFGSGQGLSDFETAGIASYFEDFKRAKTQPWAERCRLWMGTI |
| Ga0256846_11161021 | 3300028026 | Tube Worm Surface | MVDFGSGQGLSDFETAGIAGYSEDFKKAKTQPWAERC |
| Ga0256846_11388011 | 3300028026 | Tube Worm Surface | VDFGSGQGLSDFETAGIASYFEDFKRAKTQPWAERCRLWMGTS |
| Ga0256845_10780411 | 3300028029 | Tube Worm Surface | MVDFGSGQGLSDFETAGIASYFEDFKRAKTQPWAERCRLWMGTNYGAI |
| Ga0256845_10894642 | 3300028029 | Tube Worm Surface | MVDFGSGQGLSDFETAGIAGYFEDFKRAKTQPWAERCRLWMGNN |
| (restricted) Ga0233414_100616332 | 3300028045 | Seawater | MVDFGSGQGLNVFETAGIAGYSEDFKKVKTQPWAKRCLLWRDTI |
| (restricted) Ga0233414_101949001 | 3300028045 | Seawater | MVDFGSEQGLSDFETAGIARYSEDFKRAKTPLWAKRCR |
| Ga0257125_10567923 | 3300028195 | Marine | MVDFGSGQGLNIFATAGIARYFEDCKKVKTPAWAKRCRFWMDIICYTP |
| Ga0307441_12258471 | 3300031276 | Salt Marsh | CVRPEMVDFGSEQGLSNFETAVIAGYFEDFKRAKTPPRAERCRLWTDTNYLQVT |
| Ga0316576_111983891 | 3300031727 | Rhizosphere | MVYFGSEQGLNEFETAVEMRYFEDFKRVKTPLWAKRFHLWMG |
| Ga0316585_100437773 | 3300032137 | Rhizosphere | MVDFGFAQGLSDFETGGIVGYFEDFKRAKTPLEAKRCLLWMGTHQ |
| Ga0316187_100510474 | 3300032231 | Worm Burrow | QMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPKAERCRLWMDTN |
| Ga0316187_100693303 | 3300032231 | Worm Burrow | VYPQMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMDNRKELT |
| Ga0316187_102852804 | 3300032231 | Worm Burrow | MVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCR |
| Ga0316187_104119222 | 3300032231 | Worm Burrow | GLSDFETGGIACYFEDFKRAKKPPRAERCRLWMDNRKELT |
| Ga0316198_1000000441 | 3300032251 | Sediment | MMDFGSEQGLSVFATAGIVDYSEDCKKAKTQLWAERCH |
| Ga0316198_100051746 | 3300032251 | Sediment | MVDFGSEQGLSVLATAGIVGYSEDCKKAKTQLWAERCH |
| Ga0316198_100118381 | 3300032251 | Sediment | EMVDFGSEQGLSVFATAGIVGYSEDCKKAKTQLWAERCY |
| Ga0316198_100289521 | 3300032251 | Sediment | MVDFGSEQGLSVFATAGIVNYSEDCKKAKTQLWAER |
| Ga0316196_100995041 | 3300032252 | Sediment | VHPQMVDFGSGQGLSDFETGGIACYFEDFKRAKTPPGAERCRLWMDNRKELT |
| Ga0316191_100109722 | 3300032258 | Worm Burrow | MVDFDSGQGLSDFETGGIACYFEDFKRAKKPPRAERCRLWMDNRKELT |
| Ga0316194_101397364 | 3300032262 | Sediment | MVDFGSGQGLSDFETGGIACYFEDFKRAKTPPRAERCRLRM |
| Ga0316194_109646521 | 3300032262 | Sediment | MVDFDSGQGLSDFETRGIVNYFEDFKRAKTQPWIK |
| Ga0316189_100422305 | 3300032272 | Worm Burrow | MGDFGSEQGLNDFETAGIAGYVEDSKKVKVPFRAKRCRLWM |
| Ga0316189_103141881 | 3300032272 | Worm Burrow | QGLRNFETAGIAGYFEDFKRANTPPWAERCRLWMGTNK |
| Ga0316189_105028672 | 3300032272 | Worm Burrow | MGDFGSEQGLSDFETAGIAGYSEDFKRAKTPLWAKRCRLWMGTT |
| Ga0316189_108941631 | 3300032272 | Worm Burrow | MITFISTLNSVRPQMVDFVSEQGLSDFETAGIVRYVEDLKIAKTPL |
| Ga0316189_109262503 | 3300032272 | Worm Burrow | MVDFGSGQGLSDFEAGGIACYFEDFKRAKTPLRAERCRLWMETN |
| Ga0316189_111196211 | 3300032272 | Worm Burrow | MVDFGSRQGLSDFETGGIACYFEDFKRAKTPPRAKRCRLWMDTNYVVRRLEQ |
| Ga0316197_100643451 | 3300032273 | Sediment | EMVDFGSEQGLSVFATAGIVNYSEDFKKAKTHLWAERCH |
| Ga0316193_101960463 | 3300033429 | Sediment | LSDFETGGVAGYVEDLKRAKTPLRAKRCRLWMGTN |
| Ga0316193_112389222 | 3300033429 | Sediment | MVDFGSRQGLSDFETGGIACYFEDFKRAKTPPRAERCRLWMD |
| Ga0316193_113228571 | 3300033429 | Sediment | MVDFGPEQGLSDFETGGVAGYVEDLKRAKTPLRAKRCRLWMGTSYQPL |
| ⦗Top⦘ |