| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300028026 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046784 | Gp0296316 | Ga0256846 |
| Sample Name | Tube worm associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - Tevnia |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 440506227 |
| Sequencing Scaffolds | 10 |
| Novel Protein Genes | 10 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 4 |
| All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1 |
| All Organisms → cellular organisms → Bacteria | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Annelida → Integument → Unclassified → Unclassified → Tube Worm Surface → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean: East Pacific Rise | |||||||
| Coordinates | Lat. (o) | 9.8441 | Long. (o) | -104.2969 | Alt. (m) | N/A | Depth (m) | 2511 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023595 | Metagenome / Metatranscriptome | 209 | Y |
| F025922 | Metagenome / Metatranscriptome | 199 | Y |
| F029285 | Metagenome / Metatranscriptome | 189 | Y |
| F036102 | Metagenome / Metatranscriptome | 170 | Y |
| F103060 | Metagenome | 101 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0256846_1000032 | Not Available | 59515 | Open in IMG/M |
| Ga0256846_1006377 | Not Available | 2347 | Open in IMG/M |
| Ga0256846_1007736 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 2129 | Open in IMG/M |
| Ga0256846_1015167 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| Ga0256846_1036252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1084 | Open in IMG/M |
| Ga0256846_1036769 | Not Available | 1078 | Open in IMG/M |
| Ga0256846_1084164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 775 | Open in IMG/M |
| Ga0256846_1116102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 679 | Open in IMG/M |
| Ga0256846_1138801 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| Ga0256846_1147089 | Not Available | 616 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0256846_1000032 | Ga0256846_100003237 | F029285 | MKKLKNKYDYSQYKCPFSYLKKDCGHELHGLEGYEDIYGVWCLCGFCGPVFYLDPEELKLEKII |
| Ga0256846_1006377 | Ga0256846_10063773 | F036102 | MDLKEMQALFAETANIHTPEGMAAYRAFAAALTTPILQKIEMESIMRQLFAVERLAPGAQAVYPVAEDFEIPVWVLPGLG |
| Ga0256846_1007736 | Ga0256846_10077361 | F103060 | LKKYVLSQLGYPAVDVEITEDQFESVLRVTGDFISTYFPREQKLSVFWTQPLVPTYPMPEDAYWIQEVSWDPVTTRIDDVFGAESFLFNIGNISGIQNILTDYHLLQAYRRFSQKILGTEGHWEVLGEGDGGPGDQKIRLYPTPKGSFPVVVLYMPVVNHFRSPQSKYIAHKMLLAEAKMMVGAARRKIAGIPMPDGGALSLDGDAMVAEGKEEKQNIIKEALDLGEPLSIYKW |
| Ga0256846_1015167 | Ga0256846_10151672 | F023595 | MVDFGSGQGLSDFETAGIAGYVEDFKRAKTQPWAKRCRLWMDTS |
| Ga0256846_1036252 | Ga0256846_10362521 | F023595 | FGSGQGLSDFETAGIAGYFEDFKRAKTQPWAKRCRLWMGTSYI |
| Ga0256846_1036769 | Ga0256846_10367691 | F023595 | GSGQGLSDFETAGIAGYSEDFKRAKTPPWAERCRLWMGTNL |
| Ga0256846_1084164 | Ga0256846_10841641 | F023595 | MVDFGSGQGLSDFETAGIASYFEDFKRAKTQPWAERCRLWMGTI |
| Ga0256846_1116102 | Ga0256846_11161021 | F023595 | MVDFGSGQGLSDFETAGIAGYSEDFKKAKTQPWAERC |
| Ga0256846_1138801 | Ga0256846_11388011 | F023595 | VDFGSGQGLSDFETAGIASYFEDFKRAKTQPWAERCRLWMGTS |
| Ga0256846_1147089 | Ga0256846_11470891 | F025922 | MARNRIIYASQSVWINGEVLYRVQSLGTTTTFTSEDIFELGHLDIVDVVDDVPAVAVTLNTNDFGDVKTLAVLAQVAPAKIDMDASATSVNANLVAGGSTYLHGVALADFAVTCGNLTGVTLWAPVQDECSLGTLANNIDQSLYLDEVYINSLEFSYTTGANATENYG |
| ⦗Top⦘ |