3300000872: Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M2

Overview

Basic Information

• IMG/M Taxon OID: 3300000872
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053056 | Gp0054530 | Ga0001687
• Sample Name: Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M2
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 44546970
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
• Type: Engineered
• Taxonomy: Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Bioluminescent Bay, La Paraguera, Puerto Rico
• Coordinates
  • Lat. (^o): 17.967317
  • Long. (^o): -67.018833
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023595	Metagenome / Metatranscriptome	209	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI12365J12839_1000700	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	9325
JGI12365J12839_1001085	All Organisms → cellular organisms → Bacteria	4667

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12365J12839_1000700	JGI12365J12839_10007003	F023595	MVDFGSEQGLSDFETAGIVDYFEDFKRAKTPLGAKRCHLWMDTK*
JGI12365J12839_1001085	JGI12365J12839_10010851	F023595	MVDFGSEQGLSDFSRDGTSRLIYSLRWVETAGIVDYFEDFKRAKTPLGAKDAF