| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000920 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053056 | Gp0054419 | Ga0001686 |
| Sample Name | Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and M1 (2) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 52746859 |
| Sequencing Scaffolds | 7 |
| Novel Protein Genes | 7 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Type | Engineered |
| Taxonomy | Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Bioluminescent Bay, La Paraguera, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 17.967317 | Long. (o) | -67.018833 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023595 | Metagenome / Metatranscriptome | 209 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI12573J12842_1000126 | All Organisms → cellular organisms → Bacteria | 54648 | Open in IMG/M |
| JGI12573J12842_1000165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 46129 | Open in IMG/M |
| JGI12573J12842_1000233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 34265 | Open in IMG/M |
| JGI12573J12842_1000348 | All Organisms → cellular organisms → Bacteria | 24258 | Open in IMG/M |
| JGI12573J12842_1000563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13504 | Open in IMG/M |
| JGI12573J12842_1000708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 9312 | Open in IMG/M |
| JGI12573J12842_1003853 | Not Available | 1364 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI12573J12842_1000126 | JGI12573J12842_100012648 | F023595 | MVDFGFEQGLSDLETAGIVDYFEDFQRAKTPLGAKRCRL* |
| JGI12573J12842_1000165 | JGI12573J12842_10001652 | F023595 | MVDFGSEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI* |
| JGI12573J12842_1000233 | JGI12573J12842_10002331 | F023595 | MVDFGSEQGLSDFETAGIVNYFEDFKRAKTPLGAKRCH |
| JGI12573J12842_1000348 | JGI12573J12842_100034814 | F023595 | MVDFGFEQGLSNLETAGIVDYFEDFQRAKTPLGAKRCRLWMGTI* |
| JGI12573J12842_1000563 | JGI12573J12842_10005631 | F023595 | MVDFGFEQGLSDFETAGIVDYFEDFKRAKTPLGAKRC |
| JGI12573J12842_1000708 | JGI12573J12842_10007081 | F023595 | MVDFGFEQGLGDFETAGIVDYFEDFKRAKTPLGAKRCHLW |
| JGI12573J12842_1003853 | JGI12573J12842_10038531 | F023595 | VDFGSEQGLSDLETAGIVDYFEDFKRAKTPLGAKRCHLWMDTI* |
| ⦗Top⦘ |