NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F021521

Metagenome / Metatranscriptome Family F021521

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F021521
Family Type Metagenome / Metatranscriptome
Number of Sequences 218
Average Sequence Length 42 residues
Representative Sequence MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRF
Number of Associated Samples 180
Number of Associated Scaffolds 218

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 23.11 %
% of genes near scaffold ends (potentially truncated) 41.28 %
% of genes from short scaffolds (< 2000 bps) 60.55 %
Associated GOLD sequencing projects 161
AlphaFold2 3D model prediction Yes
3D model pTM-score0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.817 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(14.679 % of family members)
Environment Ontology (ENVO) Unclassified
(33.028 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(58.257 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 218 Family Scaffolds
PF00923TAL_FSA 38.53
PF17116DUF5103 19.27
PF12704MacB_PCD 3.67
PF00588SpoU_methylase 1.83
PF08713DNA_alkylation 1.38
PF01252Peptidase_A8 1.38
PF02894GFO_IDH_MocA_C 1.38
PF07730HisKA_3 0.92
PF01103Omp85 0.92
PF06452CBM9_1 0.92
PF03606DcuC 0.92
PF0563523S_rRNA_IVP 0.92
PF01642MM_CoA_mutase 0.92
PF01175Urocanase 0.46
PF01764Lipase_3 0.46
PF03706LPG_synthase_TM 0.46
PF13424TPR_12 0.46
PF13520AA_permease_2 0.46
PF00694Aconitase_C 0.46
PF10369ALS_ss_C 0.46
PF00202Aminotran_3 0.46
PF07244POTRA 0.46
PF01244Peptidase_M19 0.46
PF02838Glyco_hydro_20b 0.46
PF00326Peptidase_S9 0.46
PF030614HBT 0.46
PF00327Ribosomal_L30 0.46
PF00154RecA 0.46
PF05893LuxC 0.46
PF01075Glyco_transf_9 0.46
PF01346FKBP_N 0.46
PF00027cNMP_binding 0.46
PF17189Glyco_hydro_30C 0.46
PF04542Sigma70_r2 0.46
PF04209HgmA_C 0.46
PF00196GerE 0.46
PF13568OMP_b-brl_2 0.46
PF16198TruB_C_2 0.46
PF16314DUF4954 0.46
PF00756Esterase 0.46
PF00106adh_short 0.46
PF08032SpoU_sub_bind 0.46

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 218 Family Scaffolds
COG0176Transaldolase/fructose-6-phosphate aldolaseCarbohydrate transport and metabolism [G] 38.53
COG0597Lipoprotein signal peptidaseCell wall/membrane/envelope biogenesis [M] 2.75
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 2.29
COG0219tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domainTranslation, ribosomal structure and biogenesis [J] 1.83
COG0565tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferaseTranslation, ribosomal structure and biogenesis [J] 1.83
COG49123-methyladenine DNA glycosylase AlkDReplication, recombination and repair [L] 1.38
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 1.38
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.92
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.92
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.92
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.92
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.92
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.46
COG3525N-acetyl-beta-hexosaminidaseCarbohydrate transport and metabolism [G] 0.46
COG3508Homogentisate 1,2-dioxygenaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.46
COG2987Urocanate hydrataseAmino acid transport and metabolism [E] 0.46
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 0.46
COG1841Ribosomal protein L30/L7ETranslation, ribosomal structure and biogenesis [J] 0.46
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.46
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.46
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.46
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 0.46
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.46
COG0545FKBP-type peptidyl-prolyl cis-trans isomerasePosttranslational modification, protein turnover, chaperones [O] 0.46
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 0.46
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.46


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.28 %
UnclassifiedrootN/A19.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000882|FwDRAFT_10066237All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → unclassified Sediminibacterium → Sediminibacterium sp.589Open in IMG/M
3300001796|JGI24121J20154_1000508All Organisms → cellular organisms → Bacteria9640Open in IMG/M
3300002161|JGI24766J26685_10008407All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2820Open in IMG/M
3300002184|JGI24770J26754_10023372All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3206Open in IMG/M
3300002275|B570J29585_1015137Not Available519Open in IMG/M
3300002408|B570J29032_109931748All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3106Open in IMG/M
3300002835|B570J40625_100000066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae129496Open in IMG/M
3300002835|B570J40625_100047495All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Asinibacterium → unclassified Asinibacterium → Asinibacterium sp. OR436203Open in IMG/M
3300003388|JGI25910J50241_10026836All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → unclassified Sediminibacterium → Sediminibacterium sp.1980Open in IMG/M
3300003394|JGI25907J50239_1003426All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3878Open in IMG/M
3300003402|JGI26528J50254_1000059All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae96635Open in IMG/M
3300003408|JGI26524J50256_1000146All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes119024Open in IMG/M
3300003431|JGI25913J50563_1038597Not Available737Open in IMG/M
3300003493|JGI25923J51411_1089307All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes521Open in IMG/M
3300003858|Ga0031656_10024156All Organisms → cellular organisms → Bacteria2529Open in IMG/M
3300003858|Ga0031656_10077505All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300004112|Ga0065166_10285990All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium670Open in IMG/M
3300004162|Ga0066433_1000011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae59820Open in IMG/M
3300004169|Ga0066436_1010691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes920Open in IMG/M
3300004178|Ga0066410_1022037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales995Open in IMG/M
3300004685|Ga0065177_1034451Not Available955Open in IMG/M
3300004786|Ga0007753_1439528All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus669Open in IMG/M
3300004787|Ga0007755_1004701Not Available636Open in IMG/M
3300004796|Ga0007763_10049353All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium538Open in IMG/M
3300005330|Ga0070690_101193901All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes607Open in IMG/M
3300005331|Ga0070670_100009239All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae8423Open in IMG/M
3300005331|Ga0070670_102156290Not Available513Open in IMG/M
3300005338|Ga0068868_100780316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes861Open in IMG/M
3300005458|Ga0070681_10803614All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes858Open in IMG/M
3300005517|Ga0070374_10053902All Organisms → cellular organisms → Bacteria2091Open in IMG/M
3300005517|Ga0070374_10504835Not Available603Open in IMG/M
3300005530|Ga0070679_100233987All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1796Open in IMG/M
3300005543|Ga0070672_101156661All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes689Open in IMG/M
3300005563|Ga0068855_102092396Not Available570Open in IMG/M
3300005581|Ga0049081_10031238All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium2024Open in IMG/M
3300005581|Ga0049081_10137432All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium899Open in IMG/M
3300005582|Ga0049080_10005532All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Asinibacterium → unclassified Asinibacterium → Asinibacterium sp. OR534376Open in IMG/M
3300005616|Ga0068852_100005400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae9140Open in IMG/M
3300005617|Ga0068859_100533423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1268Open in IMG/M
3300005656|Ga0073902_10001011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea15698Open in IMG/M
3300005657|Ga0073903_10207921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium salmoneum889Open in IMG/M
3300005659|Ga0073900_10010439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4418Open in IMG/M
3300005662|Ga0078894_10117296All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2365Open in IMG/M
3300005662|Ga0078894_10366345All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1304Open in IMG/M
3300005662|Ga0078894_10463690All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1140Open in IMG/M
3300005662|Ga0078894_11325590All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes604Open in IMG/M
3300005831|Ga0074471_11152816All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella1760Open in IMG/M
3300005836|Ga0074470_11421654All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes667Open in IMG/M
3300005836|Ga0074470_11511516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella6324Open in IMG/M
3300005941|Ga0070743_10127502All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes850Open in IMG/M
3300005961|Ga0075157_10015027All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3775Open in IMG/M
3300005986|Ga0075152_10018094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4478Open in IMG/M
3300005986|Ga0075152_10281937Not Available931Open in IMG/M
3300005989|Ga0075154_10117543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1569Open in IMG/M
3300006030|Ga0075470_10025715All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium1823Open in IMG/M
3300006046|Ga0066652_100734555All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes941Open in IMG/M
3300006056|Ga0075163_11107829Not Available801Open in IMG/M
3300006086|Ga0075019_10175694All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1260Open in IMG/M
3300006103|Ga0007813_1053847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 24-39-8827Open in IMG/M
3300006104|Ga0007882_10001587All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes13066Open in IMG/M
3300006104|Ga0007882_10025495All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2658Open in IMG/M
3300006639|Ga0079301_1003085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae7168Open in IMG/M
3300006641|Ga0075471_10032710All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella2982Open in IMG/M
3300006755|Ga0079222_12310650Not Available537Open in IMG/M
3300006805|Ga0075464_10000244All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae23304Open in IMG/M
3300006805|Ga0075464_11017962All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium520Open in IMG/M
3300007171|Ga0102977_1006202All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae5819Open in IMG/M
3300007545|Ga0102873_1153412All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes694Open in IMG/M
3300007545|Ga0102873_1169095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium salmoneum658Open in IMG/M
3300007546|Ga0102874_1016138All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2453Open in IMG/M
3300007547|Ga0102875_1102297All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium914Open in IMG/M
3300007553|Ga0102819_1094438All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium508Open in IMG/M
3300007593|Ga0102918_1022132All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium1730Open in IMG/M
3300007597|Ga0102919_1065210All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1140Open in IMG/M
3300007600|Ga0102920_1032781All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1592Open in IMG/M
3300007603|Ga0102921_1312386All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes560Open in IMG/M
3300007617|Ga0102897_1150288All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes708Open in IMG/M
3300007622|Ga0102863_1208096Not Available575Open in IMG/M
3300007634|Ga0102901_1197728All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300007681|Ga0102824_1029030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium1476Open in IMG/M
3300007862|Ga0105737_1186663Not Available546Open in IMG/M
3300008117|Ga0114351_1154127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1260Open in IMG/M
3300008119|Ga0114354_1011505All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium7692Open in IMG/M
3300008119|Ga0114354_1020872All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2962Open in IMG/M
3300008120|Ga0114355_1224876All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae575Open in IMG/M
3300009009|Ga0105105_11055489Not Available508Open in IMG/M
3300009059|Ga0102830_1054269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1212Open in IMG/M
3300009068|Ga0114973_10573425All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium580Open in IMG/M
3300009151|Ga0114962_10035111All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3409Open in IMG/M
3300009152|Ga0114980_10093202All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium1802Open in IMG/M
3300009152|Ga0114980_10139720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1438Open in IMG/M
3300009159|Ga0114978_10517035Not Available699Open in IMG/M
3300009160|Ga0114981_10056997All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium2184Open in IMG/M
3300009161|Ga0114966_10056843All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2755Open in IMG/M
3300009163|Ga0114970_10013288All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Asinibacterium → unclassified Asinibacterium → Asinibacterium sp. OR435701Open in IMG/M
3300009164|Ga0114975_10001674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae15608Open in IMG/M
3300009164|Ga0114975_10005618All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium8125Open in IMG/M
3300009181|Ga0114969_10077969All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales2161Open in IMG/M
3300009181|Ga0114969_10134911All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1562Open in IMG/M
3300009182|Ga0114959_10390768All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae682Open in IMG/M
3300009183|Ga0114974_10037270All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium3322Open in IMG/M
3300009185|Ga0114971_10009090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae6604Open in IMG/M
3300009527|Ga0114942_1001055All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae7863Open in IMG/M
3300009870|Ga0131092_10044581All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae6108Open in IMG/M
3300010158|Ga0114960_10006691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium ginsengisoli8278Open in IMG/M
3300010312|Ga0102883_1061063All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1112Open in IMG/M
3300010334|Ga0136644_10003194All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae12282Open in IMG/M
3300010344|Ga0116243_10440740All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae802Open in IMG/M
3300010388|Ga0136551_1056867All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium708Open in IMG/M
3300010400|Ga0134122_10800948All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes899Open in IMG/M
3300010885|Ga0133913_10001540All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae54884Open in IMG/M
3300010885|Ga0133913_10088760All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter8288Open in IMG/M
3300010885|Ga0133913_11772219All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1547Open in IMG/M
3300010885|Ga0133913_12324088All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1315Open in IMG/M
3300010885|Ga0133913_13482390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1027Open in IMG/M
3300010885|Ga0133913_13579238Not Available1010Open in IMG/M
3300011011|Ga0139556_1025940All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae854Open in IMG/M
3300012533|Ga0138256_10000263All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae61049Open in IMG/M
3300012533|Ga0138256_10059933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3772Open in IMG/M
3300012533|Ga0138256_10077231All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3244Open in IMG/M
3300012754|Ga0138278_1139970All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300012775|Ga0138280_1099542Not Available512Open in IMG/M
3300012829|Ga0160467_100009All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes588364Open in IMG/M
3300012921|Ga0164290_1000172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium goheungense241278Open in IMG/M
3300012921|Ga0164290_1002317All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium goheungense14296Open in IMG/M
3300012956|Ga0154020_10608234Not Available893Open in IMG/M
3300013004|Ga0164293_10085858All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2445Open in IMG/M
3300013014|Ga0164295_10066440All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2693Open in IMG/M
3300013306|Ga0163162_10518258Not Available1322Open in IMG/M
3300014055|Ga0119878_1042098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1244Open in IMG/M
3300015371|Ga0132258_13248042Not Available1120Open in IMG/M
3300015373|Ga0132257_102276772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes702Open in IMG/M
3300018414|Ga0194135_10253749All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 24-39-81193Open in IMG/M
3300018432|Ga0190275_12598233All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae583Open in IMG/M
3300018476|Ga0190274_10060157All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2806Open in IMG/M
3300020151|Ga0211736_10596872All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium2286Open in IMG/M
3300020155|Ga0194050_1092958Not Available817Open in IMG/M
3300020157|Ga0194049_1044460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1157Open in IMG/M
3300020160|Ga0211733_10885934All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1539Open in IMG/M
3300020205|Ga0211731_10265657All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae8902Open in IMG/M
3300020205|Ga0211731_10438237All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium885Open in IMG/M
3300020205|Ga0211731_11502460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium934Open in IMG/M
3300020524|Ga0208858_1021497All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium985Open in IMG/M
3300020560|Ga0208852_1005682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2800Open in IMG/M
3300020561|Ga0207934_1072458All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium573Open in IMG/M
3300020563|Ga0208082_1007501Not Available2663Open in IMG/M
3300021070|Ga0194056_10002256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae10233Open in IMG/M
3300021849|Ga0210304_1068120Not Available634Open in IMG/M
3300021963|Ga0222712_10042839All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium goheungense3445Open in IMG/M
3300022549|Ga0212091_10050062All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Emticicia → Emticicia oligotrophica1511Open in IMG/M
3300022549|Ga0212091_10148139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Segetibacter → unclassified Segetibacter → Segetibacter sp. 3557_3927Open in IMG/M
3300022592|Ga0236342_1028487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1431Open in IMG/M
3300023184|Ga0214919_10002462All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae29144Open in IMG/M
3300023184|Ga0214919_10776623All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300023311|Ga0256681_11433254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1111Open in IMG/M
3300023311|Ga0256681_11651512All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1374Open in IMG/M
3300023311|Ga0256681_12061009All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium505Open in IMG/M
3300024346|Ga0244775_10174679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium1808Open in IMG/M
3300024346|Ga0244775_10454572All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1049Open in IMG/M
3300024348|Ga0244776_10030088All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4375Open in IMG/M
3300024490|Ga0255185_1015992All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1070Open in IMG/M
3300024857|Ga0256339_1038032Not Available1033Open in IMG/M
3300024980|Ga0208882_1053139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 24-39-8626Open in IMG/M
3300025356|Ga0208870_1000203All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes10681Open in IMG/M
3300025745|Ga0255244_1012849Not Available1000Open in IMG/M
3300025899|Ga0207642_10603963Not Available683Open in IMG/M
3300025938|Ga0207704_10642996Not Available873Open in IMG/M
3300026023|Ga0207677_11825952Not Available564Open in IMG/M
3300026555|Ga0179593_1065047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp.2618Open in IMG/M
3300027084|Ga0208443_1023271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1397Open in IMG/M
3300027198|Ga0208163_1059852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium611Open in IMG/M
3300027242|Ga0208806_1081351All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300027256|Ga0208932_1007776Not Available1773Open in IMG/M
3300027259|Ga0208178_1035952Not Available914Open in IMG/M
3300027259|Ga0208178_1075782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes601Open in IMG/M
3300027281|Ga0208440_1058873Not Available830Open in IMG/M
3300027418|Ga0208022_1020821All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1534Open in IMG/M
3300027499|Ga0208788_1009908All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3527Open in IMG/M
3300027649|Ga0208960_1017834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2834Open in IMG/M
3300027673|Ga0209278_1010714All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4111Open in IMG/M
3300027689|Ga0209551_1031896All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1771Open in IMG/M
3300027694|Ga0209170_1000382All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes20373Open in IMG/M
3300027707|Ga0209443_1134030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium913Open in IMG/M
3300027707|Ga0209443_1241853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes620Open in IMG/M
3300027710|Ga0209599_10009778All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2982Open in IMG/M
3300027735|Ga0209261_10028564All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1381Open in IMG/M
3300027736|Ga0209190_1105442All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1291Open in IMG/M
3300027746|Ga0209597_1036403All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2543Open in IMG/M
3300027749|Ga0209084_1022879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3342Open in IMG/M
3300027759|Ga0209296_1252256Not Available725Open in IMG/M
3300027770|Ga0209086_10099706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga → Chitinophaga sancti1490Open in IMG/M
3300027793|Ga0209972_10463414Not Available527Open in IMG/M
3300027794|Ga0209480_10008178All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae6063Open in IMG/M
3300027805|Ga0209229_10018406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2997Open in IMG/M
3300027836|Ga0209230_10000632All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium goheungense13706Open in IMG/M
3300027843|Ga0209798_10005431All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea7262Open in IMG/M
3300027898|Ga0209067_10204258Not Available1063Open in IMG/M
3300027969|Ga0209191_1082222All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1404Open in IMG/M
3300028394|Ga0304730_1272291All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium598Open in IMG/M
3300028648|Ga0268299_1096910All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes836Open in IMG/M
3300031232|Ga0302323_100569822Not Available1224Open in IMG/M
3300031722|Ga0311351_10743191Not Available748Open in IMG/M
3300031758|Ga0315907_10041147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4105Open in IMG/M
3300031758|Ga0315907_10184385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1755Open in IMG/M
3300031758|Ga0315907_10858065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium salmoneum671Open in IMG/M
3300031784|Ga0315899_11535250All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium556Open in IMG/M
3300031786|Ga0315908_10397125Not Available1154Open in IMG/M
3300031857|Ga0315909_10456108Not Available897Open in IMG/M
3300031997|Ga0315278_10021096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae6169Open in IMG/M
3300032050|Ga0315906_10029233All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae5985Open in IMG/M
3300032177|Ga0315276_10739990All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1054Open in IMG/M
3300032516|Ga0315273_10058063All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5243Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake14.68%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine11.93%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake8.26%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.05%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.21%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.21%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent3.21%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.75%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.83%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.83%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.83%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.83%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge1.83%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge1.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.38%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.38%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.38%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.38%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.38%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.38%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.38%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.38%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.92%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.92%
Contaminated CultureEnvironmental → Terrestrial → Soil → Unclassified → Desert → Contaminated Culture0.92%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.92%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.92%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.92%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.92%
Wastewater BioreactorEngineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor0.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater0.46%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.46%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.46%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.46%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater0.46%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.46%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.46%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.46%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.46%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.46%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.46%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.46%
Serpentinite Rock And FluidEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.46%
InsectaHost-Associated → Insecta → Digestive System → Unclassified → Unclassified → Insecta0.46%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.46%
Sewage Treatment PlantEngineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant0.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300001796Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_QV12AEnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002184Freshwater and sediment microbial communities from Lake Erie, CanadaEnvironmentalOpen in IMG/M
3300002275Freshwater microbial communities from Lake Mendota, WI - 06JUL2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003402Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_1EngineeredOpen in IMG/M
3300003408Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_planEngineeredOpen in IMG/M
3300003431Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300003493Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003858Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DIEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004162Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 49_LOW8EnvironmentalOpen in IMG/M
3300004169Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 52_LOW8EnvironmentalOpen in IMG/M
3300004178Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 14_LOW5EnvironmentalOpen in IMG/M
3300004685Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004786Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004787Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004796Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005656Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-KitEngineeredOpen in IMG/M
3300005657Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulkEngineeredOpen in IMG/M
3300005659Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-KitEngineeredOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005961Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNAEngineeredOpen in IMG/M
3300005986Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006056Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNAEngineeredOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006103Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09EnvironmentalOpen in IMG/M
3300006104Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1EnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007546Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02EnvironmentalOpen in IMG/M
3300007547Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02EnvironmentalOpen in IMG/M
3300007553Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007617Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02EnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300007634Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010158Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaGEnvironmentalOpen in IMG/M
3300010312Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02EnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010344AD_JPAScaEngineeredOpen in IMG/M
3300010388Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012533Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MGEngineeredOpen in IMG/M
3300012754Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012775Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012829Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MGHost-AssociatedOpen in IMG/M
3300012921Contaminated culture microbial community from soil near Moab, Utah, USA - Microcoleus steenstrupii SON62 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012956Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MGEngineeredOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014055Sewage treatment plant microbial communities from Vermont, USA - ANOX_WEngineeredOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018414Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020155Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-10mEnvironmentalOpen in IMG/M
3300020157Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25mEnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020524Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020560Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020561Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020563Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300021070Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13mEnvironmentalOpen in IMG/M
3300021849Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022549Cold Creek_combined assemblyEnvironmentalOpen in IMG/M
3300022592Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S3EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024490Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024857Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024980Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 14_LOW5 (SPAdes)EnvironmentalOpen in IMG/M
3300025356Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025745Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027084Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027198Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes)EnvironmentalOpen in IMG/M
3300027220Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027242Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027256Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027259Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027281Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027499Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027649Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027673Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA (SPAdes)EngineeredOpen in IMG/M
3300027689Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027694Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk (SPAdes)EngineeredOpen in IMG/M
3300027707Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027735Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027794Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028648Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactorEngineeredOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FwDRAFT_1006623723300000882Freshwater And MarineMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSLIFK
JGI24121J20154_1000508113300001796Serpentinite Rock And FluidMAGYSHRTAQPPILAAFLPWGGSAGAGRVRPAGAKVRVETYFP*
JGI24766J26685_1000840733300002161Freshwater And SedimentMAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIIEINEGKN*
JGI24770J26754_1002337223300002184Freshwater And SedimentMAGYLHRAATTAYLAAFLPWEGSAGAGRVRPAAANIGQKVFYKK*
B570J29585_101513723300002275FreshwaterMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSLIFKVLNKPNY
B570J29032_10993174813300002408FreshwaterCLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKIIEINEGKN*
B570J40625_100000066313300002835FreshwaterMAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKIIEINEGKN*
B570J40625_10004749573300002835FreshwaterVAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGANVGQIEGFTKCY*
JGI25910J50241_1002683623300003388Freshwater LakeMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAVAKVRFALNSP*
JGI25907J50239_100342643300003394Freshwater LakeVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMD*
JGI26528J50254_1000059813300003402Wastewater BioreactorMASYLYHTAQPPTLAAFRPWGSSAGAGRIRLATAKIKQLHQKEK*
JGI26524J50256_1000146473300003408Wastewater BioreactorMAGYSHRTATTIYLAAFRPWGGSTGAGRVRPAGAKIQAQGIFPQKKAL*
JGI25913J50563_103859723300003431Freshwater LakeVAGYSHRTAQPLILAVFLPWGSSAGAGRVRPAGANVGQIEGLKKSQ
JGI25923J51411_108930713300003493Freshwater LakeMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGTKVRFALNSP*
Ga0031656_1002415643300003858Freshwater Lake SedimentMAGDLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIGEKYMLTVDG*
Ga0031656_1007750513300003858Freshwater Lake SedimentKMAGDLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIGEKYMLTVDG*
Ga0065166_1028599023300004112Freshwater LakeVAGYSHRTAQPPILATFLSWGGSAGAGRVRPAGANVGQMKGLKKGK*
Ga0066433_100001193300004162Freshwater SedimentMAGYFIAPLQPPILAAFLPWGGSAGAGRVRPAAAKVRVEPVFS*
Ga0066436_101069123300004169FreshwaterMAGYLHRTATTAYLAAFLPWGGSAGAGRVRPAAAKVRVEPVFS*
Ga0066410_102203723300004178Freshwater SedimentVIATDPTPFAKKEKMAGYSHRTAQPPILAVFLPWGVSAGAGRMRPAAAKVRFEN*
Ga0065177_103445123300004685FreshwaterMAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAAAKVRFER*
Ga0007753_143952813300004786Freshwater LakeVAGYSHHTAQPPILAVFLPWGNSAGAGRVRPAGANVGQMD*
Ga0007755_100470123300004787Freshwater LakeMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSLIFKALN
Ga0007763_1004935313300004796Freshwater LakeVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN*
Ga0065714_1003992213300005288Miscanthus RhizosphereMASDLHRTAQPRTLAMFPLGESAGAGRVGLAGANIQSFYIFA
Ga0070690_10119390113300005330Switchgrass RhizosphereHRTAQPPTLAAFRPWEGSAGAGRVRPAAANIRMFKLRNLIFEVYR*
Ga0070670_10000923983300005331Switchgrass RhizosphereMAGYLHRTATTAYLAIFRSWGSSAGAGRIRPAGANIIGFDVENL*
Ga0070670_10215629013300005331Switchgrass RhizosphereKKGRLIHRTAQPNILAAFLPWGGSKGAGRVRPAAANIVHEMKLEK*
Ga0068868_10078031623300005338Miscanthus RhizosphereMAGYLHRTATTAYLAIFRSWGSSAGAGRIRPAGANIGGLDV*
Ga0070681_1080361423300005458Corn RhizosphereMAGLLHRTATTPTLAAFRPWEDSAGAGRVRPAAAKIMINV*
Ga0070374_1005390243300005517Freshwater LakeMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP*
Ga0070374_1050483513300005517Freshwater LakeVAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGTK
Ga0070679_10023398733300005530Corn RhizosphereMAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAAAKIMINV*
Ga0070672_10115666123300005543Miscanthus RhizosphereMAGYLHRTATTAYLAIFRSWGSSAGAGRIRPAGANIGGFHV*
Ga0068855_10209239623300005563Corn RhizosphereMASYLYRTAQPPILAAFLPWGGSAGAGRIRLAGAKVGVFG*
Ga0049081_1003123833300005581Freshwater LenticKVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN*
Ga0049081_1013743213300005581Freshwater LenticVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAAANVGQMN*
Ga0049080_1000553253300005582Freshwater LenticHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN*
Ga0068852_10000540073300005616Corn RhizosphereMAGYLHRTATTAYLAIFRSWGSSAGAGRIRPAAANIG*
Ga0068859_10053342323300005617Switchgrass RhizosphereMAGLLHRTAQPPTLAAFRPWEGSAGAGRVRPADAKIRV*
Ga0073902_10001011123300005656Activated SludgeMAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAVAKIRV*
Ga0073903_1020792123300005657Activated SludgeMAGYSHRTAQPLILAAFLPWGGSAGAGRARPATPQK*
Ga0073900_1001043913300005659Activated SludgeGKKMAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAVAKIRV*
Ga0078894_1011729633300005662Freshwater LakeVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAGANVGQMRGLKKRWNN*
Ga0078894_1036634533300005662Freshwater LakeMAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAK
Ga0078894_1046369033300005662Freshwater LakeMAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIIEISEVNIELTVNLP
Ga0078894_1132559023300005662Freshwater LakeKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP*
Ga0074471_1115281623300005831Sediment (Intertidal)MAGLLHRTAQPPTLAAFRPWEGSAGAGRVRPAAAKIRVWPYL*
Ga0074470_1142165413300005836Sediment (Intertidal)MAGLLHRTAQPPTLAAFRPWEVSAGAGRVRPAVAKIRS*
Ga0074470_1151151663300005836Sediment (Intertidal)MAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAAAKISMMNED*
Ga0070743_1012750223300005941EstuarineMASYLYHTAQPITLAAFPPWGSSSGASCIGLAGANVSCIFQLSK*
Ga0075157_1001502723300005961Wastewater EffluentVAGYSHRTAQPPILAVFLPWGGSAGAGRIRPADAKIRE*
Ga0075152_1001809423300005986Wastewater EffluentVAGYSHRTAQPPILAVFLPWGGSAGAGRIRPATAKIRD*
Ga0075152_1028193713300005986Wastewater EffluentVAGYSHRTAQPPTLAAFRPWEDSAGAGRVRPAGAKIRQ
Ga0075154_1011754313300005989Wastewater EffluentMKKVAGYSHRTAQPPTLAAFRPWEDSAGAGRVRPAGA
Ga0075470_1002571523300006030AqueousMAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAAANVG*
Ga0066652_10073455523300006046SoilMAGYLHRTAQPLILAAFRPWGDSAGAGRIRPAAAKIGKHG*
Ga0075163_1110782923300006056Wastewater EffluentMAGYSHRTATTAYLAAFRPWGGSAGAGRVRPAGAKIRKV*
Ga0075019_1017569433300006086WatershedsMAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAGAKVRFEY*
Ga0007813_105384723300006103FreshwaterRKKMAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAAAKVRFER*
Ga0007882_10001587103300006104FreshwaterVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVL*
Ga0007882_1002549523300006104FreshwaterMAGYSHRTATTAYLAAFLPWGGSAGAGRVRPAGAKVRIEK*
Ga0079301_100308523300006639Deep SubsurfaceMAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIIEFNEEKN*
Ga0075471_1003271023300006641AqueousMAGLLHRTAQPLTLAAFRPWEGSAGAGRVRPAGQI*
Ga0079222_1231065013300006755Agricultural SoilMAGLLHRTAQPPTLAAFLPWEGSAGAGRVRPAGAKISLALLTQAHFLKII*
Ga0075464_10000244123300006805AqueousVAGYSHRTAQPLILAVFLPWGSSAGAGRVRPAGANVGQIEGLKKSQ*
Ga0075464_1101796213300006805AqueousAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGANVGQIEGSTKRY*
Ga0102977_100620243300007171Freshwater LakeMAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKIIEFSEEKH*
Ga0102873_115341213300007545EstuarineHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP*
Ga0102873_116909523300007545EstuarineMAGYSHRTAQPLILATFLAWGDSAGAGRVRPADANVGQRMD*
Ga0102874_101613833300007546EstuarineMAGYSHRTAQPLILATFLSWGDSAGAGRVRPAGANVG*
Ga0102875_110229723300007547EstuarineSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN*
Ga0102819_109443813300007553EstuarineKMAGYSHRTAQPLILATFLSWGDSAGAGRVRPAGANVG*
Ga0102918_102213213300007593EstuarineRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP*
Ga0102919_106521023300007597EstuarineMAGYSHRTAQPLLLAVFLPWGGSAGAGRVRPAGAKVRFALNSP*
Ga0102920_103278123300007600EstuarineRNRRGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP*
Ga0102921_131238623300007603EstuarineMAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVGQMRGLKKTK*
Ga0102897_115028823300007617EstuarineAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP*
Ga0102863_120809613300007622EstuarineMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGANVG
Ga0102901_119772823300007634EstuarineQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP*
Ga0102824_102903023300007681EstuarineVAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGANVGQMN*
Ga0105737_118666323300007862Estuary WaterMAGYSHRTAQPLILATFLSWGDSAGAGRVRPADANVGQRMD*
Ga0114351_115412733300008117Freshwater, PlanktonMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRF
Ga0114354_101150583300008119Freshwater, PlanktonRGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP*
Ga0114354_102087213300008119Freshwater, PlanktonRGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPADTKVRFALNSP*
Ga0114355_122487613300008120Freshwater, PlanktonMAGYFHRTAQPPTLAAFPPWGSSAGAGRVRPAGAKI*
Ga0105105_1105548913300009009Freshwater SedimentMAGDLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIGKKYK
Ga0102830_105426913300009059EstuarineHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN*
Ga0114973_1057342513300009068Freshwater LakeGYSHHTAQPPILAVFLPWGSSAGAGRVRPADANVGQMN*
Ga0114962_1003511153300009151Freshwater LakeVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAGANVG*
Ga0114980_1009320213300009152Freshwater LakeGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN*
Ga0114980_1013972033300009152Freshwater LakeMAGYSHRTAQPLVLAVFLPWGVSAGAGRVRPATANVGGSCLLTN*
Ga0114978_1051703523300009159Freshwater LakeMYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADAKITVFLKENK*
Ga0114981_1005699733300009160Freshwater LakeVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVAQLN*
Ga0114966_1005684333300009161Freshwater LakeMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADAKITVFLKENK*
Ga0114970_1001328833300009163Freshwater LakeMAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAKAKVRFEA*
Ga0114975_10001674103300009164Freshwater LakeVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAGANVVN*
Ga0114975_1000561863300009164Freshwater LakeMAGYSHRTAQPLVLAVFLPWGVSAGAGRVRPAAANVGGSCLLTN*
Ga0114969_1007796913300009181Freshwater LakeMYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPAD
Ga0114969_1013491123300009181Freshwater LakeEMYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADTKITVFLKENK*
Ga0114959_1039076823300009182Freshwater LakeMAGYSHRTAQPLVLAVFLPWGVSAGAGRVRPAAANVGGSYLLTN*
Ga0114974_1003727023300009183Freshwater LakeVAGYSHHTAQPPILAVFLPWGSSAGAGRARPAGANVAQLN*
Ga0114971_1000909043300009185Freshwater LakeMYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADTKITVFLKENK*
Ga0114942_100105553300009527GroundwaterMAGYSHRTAQPPTLAAFPPWEGSAGAGRVRPAAANIQVR*
Ga0105164_1060160023300009777WastewaterLKFLNTPLGDVGKKMAGLLHRTAQPPTLAAFRPWEGSAGAGRVRPAVAK
Ga0131092_1004458153300009870Activated SludgeVAGYSHRTAQPPILAVFLPWGGSAGAGRIRPAAANVRFLNF*
Ga0114960_1000669123300010158Freshwater LakeVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAVANVAQLN*
Ga0102883_106106323300010312EstuarineFEILKMAGYSHRTAQPLILATFLSWGDSAGAGRVRPAGANVG*
Ga0136644_1000319413300010334Freshwater LakeMAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAGAKVRFEN*
Ga0116243_1044074023300010344Anaerobic Digestor SludgeVAGYSHRTAQPPILAVFLPWGGSAGAGRIRPATAKIGVHDK*
Ga0136551_105686723300010388Pond Fresh WaterVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVGQMRGLKKTK*
Ga0134122_1080094823300010400Terrestrial SoilAGLLHRTAQPPTLAAFRPWEGSAGAGRVRPAGAKIRTFEV*
Ga0133913_10001540183300010885Freshwater LakeMAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKINKISEGKN*
Ga0133913_1008876033300010885Freshwater LakeMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPANANI*
Ga0133913_1177221913300010885Freshwater LakeVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPADANVGQMN*
Ga0133913_1232408813300010885Freshwater LakeKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKITVFFKENK*
Ga0133913_1348239013300010885Freshwater LakeGYSHRTAQPPILAVFLPWGVSAGAGRVRPATAKVRFEA*
Ga0133913_1357923833300010885Freshwater LakeVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANV
Ga0139556_102594023300011011FreshwaterVAGYSHRTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN*
Ga0138256_10000263163300012533Active SludgeMASYLYHTAQPPTLAAFRPWGSSAGAGCIRLAAAKIKQMHQKEK*
Ga0138256_1005993313300012533Active SludgeLLHRTAQPPTLAAFRPWEDSAGAGRVRPAAAKIRV*
Ga0138256_1007723113300012533Active SludgeLHRTAQPPTLAAFRPWEGSAGAGRVRPAGAKIRV*
Ga0138256_1011143713300012533Active SludgePLGDGGKKMAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAVAKIRV*
Ga0138278_113997013300012754Freshwater LakeMAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAAANVGQNK
Ga0138280_109954223300012775Freshwater LakeMAGYSHRTAQPPILAVFLPWGVSAGAGRVRPATAKVRFEA*
Ga0160467_1000093573300012829InsectaVASYLYRTAQPLILAAFLPWGGSVGAGRIRLAAAKVGGIMKRIKF*
Ga0164290_10001721103300012921Contaminated CultureVIPSRAKGEKMAGYSHRTAQPPILAAFLPWGGSAGAGRVRPAAAKVRVDTYFP*
Ga0164290_100231783300012921Contaminated CultureMAGYSHRTAQPPILAAFLPWGGSAGAGRVRPAGAKVRVGSYFP*
Ga0154020_1006240213300012956Active SludgePLGDGGKKMAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAAAKIRV*
Ga0154020_1060823423300012956Active SludgeMASYLYHTAQPPTLAAFRPWGSSAGAGCIRLAAAKIKQMHQKEK
Ga0164293_1008585843300013004FreshwaterMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAK
Ga0164295_1006644043300013014FreshwaterMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADANIAHFLKIF*
Ga0170791_1434795023300013295FreshwaterMYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRV
Ga0163162_1051825833300013306Switchgrass RhizosphereMAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAAANIGKNFRRK
Ga0119878_104209823300014055Sewage Treatment PlantMAGYSHRTAQPPILAVFLPWGVSAGAGRIRPASAKVRVLIF*
Ga0132258_1324804213300015371Arabidopsis RhizosphereMAGLLHRTAQPPTLAAFLPWEGSAGAGRVRPAGANVIIND*
Ga0132257_10227677213300015373Arabidopsis RhizosphereYSHRTAQPPTLAAFRPWEGSAGAGRVRPAGTKISEKFEV*
Ga0194135_1025374923300018414WatershedsMAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAGAKVRFEY
Ga0190275_1259823313300018432SoilKKMASYLHRTAQPLTLATFRSWGSSAGAGRIRLAGANIRDYALNNSECYLL
Ga0190274_1006015713300018476SoilMAGYLHRTAQPPILAAFRPWGDSAGAGRIRPAAAKIGK
Ga0211736_1059687223300020151FreshwaterVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN
Ga0194050_109295823300020155Anoxic Zone FreshwaterMAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAKAKVRFEA
Ga0194049_104446023300020157Anoxic Zone FreshwaterMAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAAAKVRFER
Ga0211733_1088593413300020160FreshwaterIPRNRRGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP
Ga0211731_1026565733300020205FreshwaterMAGYSHRTAQPLILATFLSWGDSAGAGRVRPAGANVG
Ga0211731_1043823723300020205FreshwaterVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAAANVGQMN
Ga0211731_1150246023300020205FreshwaterVAGYSHHTAQPPILAVFLPWGSLAGAGRVRPAGANVGQMN
Ga0208858_102149723300020524FreshwaterAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKIIEINEGKN
Ga0208852_100568223300020560FreshwaterMAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGAKVRFALNSP
Ga0207934_107245813300020561FreshwaterHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN
Ga0208082_100750123300020563FreshwaterVAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP
Ga0194056_1000225693300021070Anoxic Zone FreshwaterVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVAQLN
Ga0210304_106812013300021849EstuarineMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNS
Ga0222712_1004283913300021963Estuarine WaterSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP
Ga0212091_1005006233300022549GroundwaterMAGYSHRTAQPPTLAAFPPWEGSAGAGRVRPAAANIQV
Ga0212091_1014813923300022549GroundwaterAVKEEKKMAGYSHRTAQPPTLAAFPPWEGSAGAGRVRPAAANIQVR
Ga0236342_102848713300022592FreshwaterKVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVL
Ga0214919_10002462123300023184FreshwaterMAGYSHRTAQPPILAVFLPWGVSAGAGRVRPATAKVRFEA
Ga0214919_1077662323300023184FreshwaterMAGYSHRTAQPLVLAVFLPWGVSAGAGRVRPATANVGGSCLLTN
Ga0256681_1143325423300023311FreshwaterLKYKKVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVL
Ga0256681_1165151233300023311FreshwaterVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANV
Ga0256681_1206100913300023311FreshwaterHLKYKKVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVA
Ga0244775_1017467923300024346EstuarineVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMD
Ga0244775_1045457223300024346EstuarineYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN
Ga0244776_1003008853300024348EstuarineMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFAL
Ga0255185_101599213300024490FreshwaterMAGLLHRTAQPLTLAAFRPWEGSAGAGRVRPAGTNLMNI
Ga0256339_103803223300024857FreshwaterVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVGQKGGLKKTKRE
Ga0208882_105313923300024980Freshwater SedimentRKKEKMAGYSHRTAQPPILAVFLPWGVSAGAGRMRPAAAKVRFEN
Ga0208870_100020383300025356FreshwaterVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVL
Ga0255244_101284913300025745FreshwaterMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAVAKVRFALNSP
Ga0207642_1060396323300025899Miscanthus RhizosphereMAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAAANIGKNF
Ga0207704_1064299613300025938Miscanthus RhizosphereMAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAAANIGKNFRRKRQDAEG
Ga0207677_1182595223300026023Miscanthus RhizosphereMAGLLHRTAQPPTLAAFLPWEGSAGAGRVRPAAANIVYEFK
Ga0179593_106504713300026555Vadose Zone SoilMASYLHRTAQPSTLAAFRPWGSSTGAGRIRLAAANIRAYHKYVSQFLI
Ga0208443_102327113300027084EstuarineMAGLLHRTAQPLTLAAFRPWEGSAGAGRVRPATAKLMN
Ga0208163_105985223300027198EstuarineVAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGANVGQMN
Ga0208927_102664523300027220EstuarineVAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGAKVVKTD
Ga0208806_108135123300027242EstuarinePRNRRGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP
Ga0208932_100777623300027256EstuarineMAGLLHRTAQPLTLAAFRPWEGSAGAGRVRPAGAKVRFALNSP
Ga0208178_103595223300027259EstuarineMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFA
Ga0208178_107578223300027259EstuarineHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP
Ga0208440_105887323300027281EstuarineVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVG
Ga0208022_102082133300027418EstuarineMAGLLHRTAQPLTLAAFRPWEGSAGAGRVRPAGTN
Ga0208788_100990833300027499Deep SubsurfaceMAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIIEFNEEKN
Ga0208960_101783413300027649Freshwater LenticVAGYSHHTAQPPILAVFLPWGNSAGAGRVRPAGANVGQMD
Ga0209278_101071443300027673Wastewater EffluentVAGYSHRTAQPPILAVFLPWGGSAGAGRIRPADAKIRE
Ga0209551_103189613300027689Freshwater LakeYSHHTAQPPILAVFLPWGNSAGAGRVRPAGANVGQMD
Ga0209170_1000382133300027694Activated SludgeMAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAVAKIRV
Ga0209443_113403023300027707Freshwater LakeMAGYSHRTAQPLILATFLSWGDSAGAGRVRPADANVGQRMD
Ga0209443_124185313300027707Freshwater LakeHRTAQPLILAVFLPWGGSAGAGRVRPAGTKVRFALNSP
Ga0209599_1000977823300027710Deep SubsurfaceMAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAGAKVRFEN
Ga0209261_1002856433300027735Wetland SedimentMAGLLHRTAQPPTLAAFRPWEGSAGAGRVRPAGAKIREQR
Ga0209190_110544223300027736Freshwater LakeKKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADAKITVFLKENK
Ga0209597_103640323300027746Freshwater LakeMYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADTKITVFLKENK
Ga0209084_102287923300027749Freshwater LakeVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAGANVG
Ga0209296_125225623300027759Freshwater LakeVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVAQL
Ga0209086_1009970623300027770Freshwater LakeMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADAKITVFLKENK
Ga0209972_1046341423300027793Freshwater LakeVAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGAKVGK
Ga0209480_1000817823300027794Wastewater EffluentVAGYSHRTAQPPILAVFLPWGGSAGAGRIRPATAKIRD
Ga0209229_1001840623300027805Freshwater And SedimentMAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIIEINEGKN
Ga0209230_10000632133300027836Freshwater And SedimentIPRNRRGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPADTKVRFALNSP
Ga0209798_1000543113300027843Wetland SedimentKMAGLLHRTAQPPTLAAFRPWEGSAGAGRVRPAGAKIREQR
Ga0209067_1020425833300027898WatershedsMAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAGAKVRFE
Ga0209191_108222223300027969Freshwater LakeMAGYSHRTAQPLVLAVFLPWGVSAGAGRVRPAAANVGGSCLLTN
Ga0304730_127229113300028394Freshwater LakeAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADAKITVFLKENK
Ga0268299_109691013300028648Activated SludgeYSSEVKKMAGYSHRTAQPPILAVFLPWGVSAGAGRIRPASAKVRVLIF
Ga0302323_10056982233300031232FenMAGDLHRTAQPPTLAAFRPWGGSAGAGRTRPAGANIGMN
Ga0311351_1074319123300031722FenMAGLLHRTAQPPTLAAFRPWEVSAGAGRVRPAVAKIRS
Ga0315907_1004114723300031758FreshwaterMAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKIIEINEGKN
Ga0315907_1018438533300031758FreshwaterMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADANIKKFKRPFKNTMAEI
Ga0315907_1085806523300031758FreshwaterMAGYSHRTAQPLILAAFLPWGGSAGAGRARPATPQK
Ga0315899_1153525023300031784FreshwaterAGYSHRTAQPLILATFLSWGGSAGAGRVRPAGANVGQMRGLKKRWNN
Ga0315908_1039712513300031786FreshwaterAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP
Ga0315909_1045610823300031857FreshwaterVAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGAKV
Ga0315278_1002109653300031997SedimentMAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAGAKIWKNHKKRLNLD
Ga0315906_1002923333300032050FreshwaterMAGDLHRTAQPPTLAAFRPWGSSAGAGRVRPASANVKQLKK
Ga0315276_1073999033300032177SedimentMAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAGAKIRKNHK
Ga0315273_1005806323300032516SedimentMAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAGAKIRKNHKKRLNLD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.